DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Angptl3

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_006238502.1 Gene:Angptl3 / 502970 RGDID:1564505 Length:455 Species:Rattus norvegicus


Alignment Length:467 Identity:107/467 - (22%)
Similarity:177/467 - (37%) Gaps:141/467 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILILSLSISTSLANDPQRS-FDQNADNPCSAHRIWVWRPILDRFAKVNSSDELKNQVNAMSETI 73
            |:.::.|.||:.:  ||..| ||.....|.|            |||.::....|.|.:..:...:
  Rat     7 LLFVVPLVISSRV--DPDLSPFDSVPSEPKS------------RFAMLDDVKILANGLLQLGHGL 57

  Fly    74 KDL--QTRIGHKNEL-------------LLLQAGQIKDQSARLNVLIKNMKVLRSECLNAQAEIK 123
            ||.  :|: |..|::             |.||..:||::...|......::|...|..|...|:.
  Rat    58 KDFVHKTK-GQINDIFQKLNIFDQCFYDLSLQTNEIKEEEKELRRTTSKLQVKNEEVKNMSLELN 121

  Fly   124 SK----------------DIQIQLSA--------------------------------------- 133
            ||                .::.||::                                       
  Rat   122 SKLESLLEEKMALQHRVRALEEQLTSLVQNPPGAREHPEVTSLKSFVEQQDNSIRELLQSVEEQY 186

  Fly   134 -------AKIKQMSNEL-------VTQCS----------------------RQDTCPID-----G 157
                   .:||::.|:|       .|:.|                      .||..|.|     .
  Rat   187 KQLSQQHIQIKEIENQLRKTGIQEPTENSLYSKPRAPRTTPPLHLKEAKNIEQDDLPADCSAIYN 251

  Fly   158 KG----GIYKLKIRELPAFEAPC---SSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIG 215
            :|    |:|.::......|...|   |......||.|.||::||::.|::|:.||||:.|||::|
  Rat   252 RGEHTSGVYTIRPSSSQVFNVYCDTQSGTPRTLIQHRKDGSQNFNQTWENYEKGFGRLDGEFWLG 316

  Fly   216 LEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAGDSLRPHERQ 280
            |||::.:.:|..:.|.::|.....:..:|.| :|.||....:|.| .:........::|..|...
  Rat   317 LEKIYAIVKQSNYILRLELQDWKDSKHYAEY-SFHLGNHETNYTL-HVAEIAANIPEALPEHRDL 379

  Fly   281 KFTTNDKDNDAYRFNCAADEYGGWWYYD-CAKSMLNGKFYK-EGRSRNGKTNGILWGSWHNNDWT 343
            .|:|.|.......: |.....||||:.| |.::.||||:.| ..:|:..:..||.|..  .....
  Rat   380 MFSTWDHRAKGQLY-CPESYSGGWWFSDMCGENNLNGKYNKPRAKSKPERRRGISWRP--RGGKL 441

  Fly   344 YSLTFVEMMIRP 355
            ||:...:||::|
  Rat   442 YSIKSSKMMLQP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 61/201 (30%)
Angptl3XP_006238502.1 SPEC <34..193 CDD:295325 25/171 (15%)
FReD 241..453 CDD:238040 63/216 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.