DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and MFAP4

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001185624.1 Gene:MFAP4 / 4239 HGNCID:7035 Length:279 Species:Homo sapiens


Alignment Length:192 Identity:77/192 - (40%)
Similarity:108/192 - (56%) Gaps:10/192 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 LPAFEAPCSSNG-WLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYI 232
            :|.|....:..| |...|||::|:.:|.|||.|||.||||..||:::||:.:||:|.::::||.:
Human    90 VPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRV 154

  Fly   233 KLGKIDGTTSHAHYDNFEL-----GGEIESYELKSLGRYNGTAGDSLRPHERQKFTTNDKDNDAY 292
            .|...:..|::|.|.:|.:     ..|.:.|.|...|..:|.|||||..|..|||:|.|:|.|.:
Human   155 DLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLF 219

  Fly   293 RFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIR 354
            ..||||...|.:|:..|..:.||| ||. |.|.....|||.|..|  ..:.|||...||.||
Human   220 VQNCAALSSGAFWFRSCHFANLNG-FYL-GGSHLSYANGINWAQW--KGFYYSLKRTEMKIR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 77/192 (40%)
MFAP4NP_001185624.1 FReD 60..278 CDD:238040 77/192 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.