DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and fga

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001181918.1 Gene:fga / 378986 ZFINID:ZDB-GENE-031010-21 Length:684 Species:Danio rerio


Alignment Length:228 Identity:82/228 - (35%)
Similarity:122/228 - (53%) Gaps:38/228 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 GKGGIYKLKIRELPA-----FEAPCSSN----GWLTIQKRYDGAENFDRGWKDYKDGFGRV---- 208
            |:.|::|:|    ||     .|..|..:    ||..:|:|.||:.||:|.||:|.:|||::    
Zfish   465 GQSGMFKIK----PAGSEEVVEVYCDQSTGLGGWTLVQQREDGSVNFNRTWKEYLNGFGQIDKQG 525

  Fly   209 RGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAGDS 273
            :||.:||.:.:||:| |:...|.::|....|..::|.| |.::|.|.|.:.| :...|:|.|||:
Zfish   526 KGEIWIGNKFLHLLT-QKESLLRVELQDWTGAEAYAEY-NIKVGSEAEGFPL-TASDYDGDAGDA 587

  Fly   274 L---RP-------HERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGK 328
            |   .|       |...||:|.|:|:|.:..|||....|||||.:|..:.|||.:||.|:.....
Zfish   588 LVRGHPNLGSFLSHAGMKFSTFDRDSDKWEENCAEMYGGGWWYNNCQSANLNGIYYKGGQYDPAT 652

  Fly   329 ------TNGILWGSWHNNDWTYSLTFVEMMIRP 355
                  .||::|..:...|  |||..|.|.|||
Zfish   653 KVPYEIENGVVWLPFKPAD--YSLKVVRMKIRP 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 81/225 (36%)
fgaNP_001181918.1 Fib_alpha 46..185 CDD:285864
FReD 453..684 CDD:238040 82/228 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.