DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Angptl4

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_954546.1 Gene:Angptl4 / 362850 RGDID:735058 Length:405 Species:Rattus norvegicus


Alignment Length:324 Identity:89/324 - (27%)
Similarity:146/324 - (45%) Gaps:63/324 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ETIKDLQTRIGHKNELLLLQAGQIKDQSARLNVLIKNMKVLRSECLNAQAEIKSKDIQIQLSAAK 135
            ||::.|||              |:|.|::::..|.:  ||.:.:...::..::.:::|.|:....
  Rat    99 ETLQSLQT--------------QLKAQNSKIQQLFQ--KVAQQQRYLSKQNLRIQNLQSQIDLLT 147

  Fly   136 IKQMSN------------------ELVTQCSRQDTCPIDGK---------GGIYKLKIRELPAFE 173
            ...:.|                  .|....:|....|.|.:         .|:::::....|.|.
  Rat   148 PTHLDNGVDKTSRGKRLPKMAQLIGLTPNATRLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFL 212

  Fly   174 APC---SSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLG 235
            ..|   |..||..||:|.:|:.:|::.|:.||||||..:|||::||||:|.:|..|..:|.::|.
  Rat   213 VNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGDRGSQLAVQLQ 277

  Fly   236 KIDGTTSHAHYDNFELGGEIESYELK-------SLGRYNGTAGDSLRPHERQKFTTNDKDNDAY- 292
            ..||......:. ..||||..:|.|:       .||..|.:......|     |:|.|:|:|.. 
  Rat   278 DWDGNAKLLQFP-IHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLP-----FSTWDQDHDLRG 336

  Fly   293 RFNCAADEYGGWWYYDCAKSMLNGK-FYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIRP 355
            ..|||....||||:..|:.|.|||: |:...|.|..:..||.|.:|...  .|.|....::|:|
  Rat   337 DLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQQRKKGIFWKTWKGR--YYPLQATTLLIQP 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 71/208 (34%)
Angptl4NP_954546.1 FReD 182..399 CDD:238040 73/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.