DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Fga

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001008724.1 Gene:Fga / 361969 RGDID:2603 Length:782 Species:Rattus norvegicus


Alignment Length:343 Identity:103/343 - (30%)
Similarity:152/343 - (44%) Gaps:76/343 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GHKNELLLL--QAGQIKDQSARLNVLIKNMKVLRSECLNA--------------QAEIKSKDIQI 129
            |..:||..:  :.|...|  :|...|..|.|...|:..::              :....||...:
  Rat   448 GRLDELSRMHPELGSFYD--SRFGSLTSNFKEFGSKTSDSDIFTDIENPSSHVPEFSSSSKTSTV 510

  Fly   130 QLSAAKIKQMSNELVTQCSRQ---------------------DTCPIDGKGGIYKLKIRELPA-- 171
            :....|..:|::|..::..::                     .|.|...:.||:.:|   ||.  
  Rat   511 RKQVTKSYKMADEAASEAHQEGDTRTTKRGRARTMRDCDDVLQTHPSGAQNGIFSIK---LPGSS 572

  Fly   172 --FEAPC----SSNGWLTIQKRYDGAENFDRGWKDYKDGFGRV----RGEFFIGLEKVHLMTRQR 226
              |...|    |..|||.||:|.||:.||:|.|:|||.|||.:    .|||::|.:.:||:| .|
  Rat   573 KIFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDKGEGEFWLGNDYLHLLT-LR 636

  Fly   227 RHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAGDSL-----------RPHERQ 280
            ...|.::|....|..::|.| :|.:|.|.|.|.|: :..|.|||||:|           ..|...
  Rat   637 GSVLRVELEDWAGKEAYAEY-HFRVGSEAEGYALQ-VSSYQGTAGDALMEGSVEEGTEYTSHSNM 699

  Fly   281 KFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGR--SRNGK----TNGILWGSWHN 339
            :|:|.|:|.|.:..|||....|||||..|..:.|||.:|..|.  .||..    .||::|..:..
  Rat   700 QFSTFDRDADQWEENCAEVYGGGWWYNSCQAANLNGIYYPGGTYDPRNNSPYEIENGVVWVPFRG 764

  Fly   340 NDWTYSLTFVEMMIRPRI 357
            .|  |||..|.|.|||.:
  Rat   765 AD--YSLRAVRMKIRPLV 780

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 85/224 (38%)
FgaNP_001008724.1 Fib_alpha 51..189 CDD:285864
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..374
Fibrinogen_aC 388..453 CDD:288972 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 522..542 1/19 (5%)
FReD 546..779 CDD:238040 87/240 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.