DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and CG31832

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:212 Identity:100/212 - (47%)
Similarity:142/212 - (66%) Gaps:9/212 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 SRQDTCPIDGKGGIYKLKIRELPAFE-APC--SSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVR 209
            |...|||.....||::|.:.|...|: ..|  ::..|:.||:|.||:.||::.|..||||||...
  Fly    20 SSPHTCPSGSPNGIHQLMLPEEEPFQVTQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPN 84

  Fly   210 GEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAGDSL 274
            |||||||:|::||||::.|||:|:|....|.|.:||:|:|::..|.|.|:|:.:|:|:|||||||
  Fly    85 GEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSL 149

  Fly   275 RPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHN 339
            |.|..::|:|.|:|||....||||:..||||::.|..|.|||.:::||.:  |..|||.||.|. 
  Fly   150 RYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGET--GMLNGIHWGRWK- 211

  Fly   340 NDWTYSLTFVEMMIRPR 356
               ..|||||::||||:
  Fly   212 ---FQSLTFVQIMIRPK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 95/198 (48%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 95/202 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446514
Domainoid 1 1.000 178 1.000 Domainoid score I7356
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I6425
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D84222at33392
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
109.900

Return to query results.
Submit another query.