DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Angptl6

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001100172.1 Gene:Angptl6 / 298698 RGDID:1311141 Length:457 Species:Rattus norvegicus


Alignment Length:431 Identity:125/431 - (29%)
Similarity:183/431 - (42%) Gaps:96/431 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LILSLSISTSLANDPQRSFDQNADNPCSAHRIWVWR-----PILDRFAKVNSSDELKNQVNAMSE 71
            |:||..::||..   .||.:.:.|:..:..|:.:.|     ..|.|.|....:  |..:|.|:.|
  Rat    31 LVLSPQMATSAV---CRSSEASQDSELATLRMRLGRHEELLRALQRRAAEGGA--LAGEVRALRE 90

  Fly    72 TIKDLQTRIGHKNELLLLQAGQIKD----QSARLNVLIKNMKVLRSECLNAQAEIKSKDIQIQLS 132
            ....|.||:|.....|..:||...|    .:|.|.:|.:......:|.....|.::..:.|::..
  Rat    91 HSLTLNTRLGQLRAQLQQEAGAEPDLGAEPAAALGLLAERALGAEAEARRTTARLQQLEEQLREH 155

  Fly   133 AAKIKQMSN---ELVTQCS-----RQDTCPI---------------------------------- 155
            |..:.|.|:   .|...|:     :|...|:                                  
  Rat   156 AQLMSQHSSLLGRLQRACASPERGQQQVLPLPLVPLVPLSLVGSASNTSRRLDQIPEHQREQSLR 220

  Fly   156 ------------------------------DGKG----GIYKLKI--RELPAF-EAPCSSNGWLT 183
                                          .|.|    |:|:|::  |.:|.: |......||..
  Rat   221 QQGPPSSPLPTGHVAVPTRPVGPWRDCAEAQGAGHWQSGVYELRLGRRVVPVWCEQQQEGGGWTV 285

  Fly   184 IQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDN 248
            ||:|.||:.||...|:.||.||||..||:::|||.||.:|.:..|||.|.|....|..:.||||:
  Rat   286 IQRRQDGSVNFFTNWQHYKVGFGRPDGEYWLGLEPVHQVTSRGDHELLILLKDWGGRGARAHYDS 350

  Fly   249 FELGGEIESYELKSLGRYNGTAGDSLRPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSM 313
            |.|..|.:.|.|: ||:|:|.|||||..|..:.|.|.|:|.|:|..|||....|||||:.||.|.
  Rat   351 FSLEPESDHYRLR-LGQYHGDAGDSLSWHSDKPFNTVDRDRDSYSGNCALYHRGGWWYHACAHSN 414

  Fly   314 LNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIR 354
            |||.:|..|..|:...:|:.|..:...  .|||....|:.|
  Rat   415 LNGVWYHGGHYRSRYQDGVYWAEFRGG--AYSLKKAAMLTR 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 85/198 (43%)
Angptl6NP_001100172.1 Uso1_p115_C 66..>157 CDD:282695 21/92 (23%)
FReD 242..453 CDD:238040 86/213 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.