DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Angpt4

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001099996.1 Gene:Angpt4 / 296269 RGDID:1307539 Length:508 Species:Rattus norvegicus


Alignment Length:406 Identity:112/406 - (27%)
Similarity:178/406 - (43%) Gaps:70/406 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ILILSLSISTSLANDPQRSFDQNADNP----------------CSAHRIW-VWRPILDRFAKVN- 57
            :|.|..||..:|.:|..::......|.                ...|::. |...:|:..::|. 
  Rat   109 LLKLEQSIQMNLRSDLAQAQQHTIQNQTTTMLALGANLMNQTMAQTHKLTAVEAQVLNHTSRVKT 173

  Fly    58 -------SSDELKNQVNAMSETIKDLQTRIGHKNELL--LLQAGQIKDQSARLNVLIKNMKVLRS 113
                   |:::|:.|:...|..::.||.|    |..|  .|||.:.:.| |:||.|....:.|:|
  Rat   174 QMLESSLSTNKLERQMLMQSRELQRLQGR----NRALETRLQALEAQHQ-AQLNSLQDKREQLQS 233

  Fly   114 ---ECLNAQAEIKSKDIQIQLSAAKIKQMSNELVTQCSR------QDTCPIDGK----------- 158
               ....|.|.:|.....:..:::.::|...:|:....|      ||..|:..|           
  Rat   234 LLGHQTGALANLKHSLRALSSNSSSLQQQQQQLMELVQRLVRIVAQDQHPVSLKTPKPLFRDCAE 298

  Fly   159 --------GGIYKL----KIRELPAF-EAPCSSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRG 210
                    .|:|.:    ..:.|..| :......||..||:|.||:.||.|.|::||:|||.|..
  Rat   299 IKRSGANTSGVYTIHGANMTKPLKVFCDMETDGGGWTLIQRREDGSLNFQRTWEEYKEGFGNVAR 363

  Fly   211 EFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELK-SLGRYNGTAGDSL 274
            |.::|.|.||.:|.:..:.|.::|...:|..:...|:||:||.|.:.|.|. :....:....:||
  Rat   364 EHWLGNEAVHSLTSRTAYLLRVELHDWEGHQTSIQYENFQLGSERQRYSLSVNDSSISARLKNSL 428

  Fly   275 RPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHN 339
            .| :..||:|.|.|||.....||....||||:..|..|.|||.:|...:..: |.|||.|..:..
  Rat   429 AP-QGTKFSTKDMDNDNCMCKCAQMLSGGWWFDACGLSNLNGIYYPVHQHLH-KINGIRWHYFRG 491

  Fly   340 NDWTYSLTFVEMMIRP 355
            .  :|||....||:||
  Rat   492 P--SYSLHGTRMMLRP 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 72/202 (36%)
Angpt4NP_001099996.1 FReD 291..506 CDD:238040 72/219 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.