DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and ANGPT2

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001138.1 Gene:ANGPT2 / 285 HGNCID:485 Length:496 Species:Homo sapiens


Alignment Length:445 Identity:123/445 - (27%)
Similarity:182/445 - (40%) Gaps:113/445 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SISTSLANDPQRSFDQNADNPCSAHRIWV----------WRPILDRFAKVNSSDE---------- 61
            |.|..::|..||......|:  |..|:.|          |...|:.:.:.|...|          
Human    56 SSSPYVSNAVQRDAPLEYDD--SVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQ 118

  Fly    62 ------------LKNQVNAMSETIKDLQTRIGHKN---ELLLLQAG--------QIKDQSARLNV 103
                        |.||....:..:.|::.::.::.   ||.||:..        ||.||::.:|.
Human   119 NQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINK 183

  Fly   104 L-IKN----MKVLRSE---CLNAQAEIKSKDIQIQLSAAK----IKQMSNELVT----------- 145
            | .||    .|||..|   .:..|: ||.:..|:|:..:|    |:::..::||           
Human   184 LQDKNSFLEKKVLAMEDKHIIQLQS-IKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQ 247

  Fly   146 ------------------------------QCSRQDTCPIDGKG----GIYKL----KIRELPAF 172
                                          |.|.:|...:...|    |||.|    ...|:.|:
Human   248 QHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAY 312

  Fly   173 -EAPCSSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGK 236
             :......||..||:|.||:.:|.|.||:||.|||...||:::|.|.|..:|.|:|:.|.|.|..
Human   313 CDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKD 377

  Fly   237 IDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAGD-SLRPHERQKFTTNDKDNDAYRFNCAADE 300
            .:|..:::.|::|.|..|..:|.:...| ..||||. |........|:|.|.|||.....|:...
Human   378 WEGNEAYSLYEHFYLSSEELNYRIHLKG-LTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQML 441

  Fly   301 YGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIRP 355
            .||||:..|..|.|||.:|.: |....|.|||.|..|..:.  |||....|||||
Human   442 TGGWWFDACGPSNLNGMYYPQ-RQNTNKFNGIKWYYWKGSG--YSLKATTMMIRP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 77/202 (38%)
ANGPT2NP_001138.1 SMC_N <78..>295 CDD:330553 39/217 (18%)
FBG 280..494 CDD:214548 80/218 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.