DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and ANGPT1

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001137.2 Gene:ANGPT1 / 284 HGNCID:484 Length:498 Species:Homo sapiens


Alignment Length:366 Identity:109/366 - (29%)
Similarity:167/366 - (45%) Gaps:46/366 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ISTSLANDPQRSFDQNADNPCSAHRIWVWRPILDRFAKVNSSDELK-NQVNAMSETIKDLQTRIG 81
            :.|.:.|...|...|..:|..|.::       |::.....:::.|| ::.|::.|. |.|:....
Human   148 VETQVLNQTSRLEIQLLENSLSTYK-------LEKQLLQQTNEILKIHEKNSLLEH-KILEMEGK 204

  Fly    82 HKNELLLLQAGQIKDQSARLNVLIKNMKVLRSECLNAQAEIKSKDIQIQLSAAKIKQMSNELVTQ 146
            ||.||     ..:|::...|..|:.....:..|.........:.:..:|....::....:.||..
Human   205 HKEEL-----DTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNL 264

  Fly   147 CSRQDTCPIDG--------------------KGGIYKLKIRELPA-----FEAPCSSNGWLTIQK 186
            |:::......|                    |.|||.:.|..:|.     .....:..||..||.
Human   265 CTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQH 329

  Fly   187 RYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFEL 251
            |.||:.:|.||||:||.|||...||:::|.|.:..:|.||::.|.|:|...:|..:::.||.|.:
Human   330 REDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHI 394

  Fly   252 GGEIESYELKSLGRYNGTAG--DSLRPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSML 314
            |.|.::|.|...| :.||||  .||..|... |:|.|.|||.....||....||||:..|..|.|
Human   395 GNEKQNYRLYLKG-HTGTAGKQSSLILHGAD-FSTKDADNDNCMCKCALMLTGGWWFDACGPSNL 457

  Fly   315 NGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIRP 355
            ||.||..|:: :||.|||.|..:...  :|||....|||||
Human   458 NGMFYTAGQN-HGKLNGIKWHYFKGP--SYSLRSTTMMIRP 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 82/203 (40%)
ANGPT1NP_001137.2 Smc <81..280 CDD:224117 26/144 (18%)
FReD 281..496 CDD:238040 83/220 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16943
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.