DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and ANGPTL3

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_055310.1 Gene:ANGPTL3 / 27329 HGNCID:491 Length:460 Species:Homo sapiens


Alignment Length:477 Identity:118/477 - (24%)
Similarity:191/477 - (40%) Gaps:146/477 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRIMKTAYLILILSLSISTSLANDPQRSFDQNADNPCSAHRIWVWRPILDRFAKVNSSDELKNQ 65
            ||.|   ..|:.|:.|.||:.:..| ..|||..:..|.|            |||.::....|.|.
Human     1 MFTI---KLLLFIVPLVISSRIDQD-NSSFDSLSPEPKS------------RFAMLDDVKILANG 49

  Fly    66 VNAMSETIKDL--QTRIGHKNEL-------------LLLQAGQIKDQSARL----------NVLI 105
            :..:...:||.  :|: |..|::             |.||..:||::...|          |..:
Human    50 LLQLGHGLKDFVHKTK-GQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEV 113

  Fly   106 KNMKV--------LRSECLNAQAEIK-----------------------------------SKDI 127
            |||.:        |..|.:..|.::|                                   .||:
Human   114 KNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDL 178

  Fly   128 ---------QIQLSAAKIKQMSNEL-------VTQCS----------------------RQDTCP 154
                     |:....::||::.|:|       .|:.|                      :.|..|
Human   179 LQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIP 243

  Fly   155 -----IDGKG----GIYKLKIRELPAFEAPC---SSNGWLTIQKRYDGAENFDRGWKDYKDGFGR 207
                 |..:|    |:|.::......|...|   |.:.|..||.|.||::||:..|::||.||||
Human   244 AECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGR 308

  Fly   208 VRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHY--DNFELGGEIESYELKSLGRYNGTA 270
            :.|||::||||::.:.:|..:.|.|:|   :....:.||  .:|.||....:|.| .|....|..
Human   309 LDGEFWLGLEKIYSIVKQSNYVLRIEL---EDWKDNKHYIEYSFYLGNHETNYTL-HLVAITGNV 369

  Fly   271 GDSLRPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYD-CAKSMLNGKFYK-EGRSRNGKTNGIL 333
            .:::..::...|:|.|.....: |||.....||||::| |.::.||||:.| ..:|:..:..|:.
Human   370 PNAIPENKDLVFSTWDHKAKGH-FNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLS 433

  Fly   334 WGSWHNNDWTYSLTFVEMMIRP 355
            |.|  .|...||:...:|:|.|
Human   434 WKS--QNGRLYSIKSTKMLIHP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 67/203 (33%)
ANGPTL3NP_055310.1 SMC_N <84..>215 CDD:330553 22/130 (17%)
FReD 243..453 CDD:238040 69/216 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.