DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Tnr

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_037177.2 Gene:Tnr / 25567 RGDID:3886 Length:1358 Species:Rattus norvegicus


Alignment Length:336 Identity:99/336 - (29%)
Similarity:161/336 - (47%) Gaps:58/336 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 ILDRFAKVNSSDELKNQV--------NAMSETIKDLQTRIGHKNELLLLQAGQIKDQSARLNVLI 105
            :||..|.:.:|:..:...        .|:...:...::..|.:.||::    ..:|...||..|.
  Rat  1040 LLDPPANLTASEVTRQSALISWQPPRAAIENYVLTYKSTDGSRKELIV----DAEDTWIRLEGLS 1100

  Fly   106 KNMKVLRSECLNAQAEIKSKDIQIQLSAAK---IKQMSNELVTQCSRQDTCPI---------DGK 158
            :|                 .|..:.|.||:   ...:::.:.|...|..:.|.         |..
  Rat  1101 EN-----------------TDYTVLLQAAQEATRSSLTSTIFTTGGRVFSHPQDCAQHLMNGDTL 1148

  Fly   159 GGIYKLKI-----RELPAF-EAPCSSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLE 217
            .|:|.:.:     .:|..: :......||:..|:|.:|..:|.|.|.||:.|||.:..||::||:
  Rat  1149 SGVYTIFLNGELSHKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVGFGNLEDEFWLGLD 1213

  Fly   218 KVHLMTRQRRHELYIKLGKIDGTTS-HAHYDNFELGGEIESYELKSLGRYNGTAGDSLRPHERQK 281
            .:|.:|.|.|:||.:.:.  ||..: .|:||.|.:......|:|: :|.|||||||||..|:.:.
  Rat  1214 NIHRITAQGRYELRVDMR--DGQEAVFAYYDKFAVEDSRSLYKLR-IGGYNGTAGDSLSYHQGRP 1275

  Fly   282 FTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSL 346
            |:|.|:|||....|||....|.|||.:|.::.||||:   |.||:  :.||.|..|..::  :|:
  Rat  1276 FSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKY---GESRH--SQGINWYHWKGHE--FSI 1333

  Fly   347 TFVEMMIRPRI 357
            .||||.:||.|
  Rat  1334 PFVEMKMRPYI 1344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 76/202 (38%)
TnrNP_037177.2 exchanger_TraA <190..>328 CDD:411343
EGF_Tenascin 203..231 CDD:376143
fn3 328..398 CDD:394996
fn3 416..496 CDD:394996
fn3 507..586 CDD:394996
FN3 595..679 CDD:238020
fn3 687..766 CDD:394996
fn3 776..855 CDD:394996
fn3 865..944 CDD:394996
fn3 954..1026 CDD:394996
FN3 1042..1127 CDD:238020 16/105 (15%)
FReD 1134..1342 CDD:238040 77/217 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.