DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and CG30281

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster


Alignment Length:287 Identity:100/287 - (34%)
Similarity:155/287 - (54%) Gaps:36/287 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LLLLQAGQIKD--QSARLNVLIKNMKVLRSECLNAQAEIKSKDIQIQLSAAKIKQMSNELVTQCS 148
            :|:|..|.:..  ||.:|:::.|          .|::.:.|..|:::    ::||...|:..:..
  Fly     8 VLILSGGSLLSTAQSNKLDLVYK----------KAESMVSSLKIRLE----ELKQSYKEITEERG 58

  Fly   149 RQDT-----CPIDG--KGGIYKLKIRELPAFEAPC----SSNGWLTIQKRYDGAENFDRGWKDYK 202
            ..:|     |...|  ..||:.:::..|..|...|    :.:||..||:|.||:|||.|.|::|.
  Fly    59 SHETINPSSCLAAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYS 123

  Fly   203 DGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYN 267
            .|||.:.||||:||||:|.:|....:||::.:...:|....|.|::|.:|....||.|..||:|:
  Fly   124 QGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYS 188

  Fly   268 GTAGDSLRPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGR---SRNGKT 329
            |.||||||.|:...|:|.|.|:..:  .||....|.|||..|.:|.|||::.:.||   ..:|: 
  Fly   189 GDAGDSLRYHKGMPFSTFDHDDTGH--GCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGR- 250

  Fly   330 NGILWGSWHNNDWTYSLTFVEMMIRPR 356
             ||.|.||...|:.|.  ||:|||||:
  Fly   251 -GITWMSWRGYDYGYK--FVQMMIRPK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 83/202 (41%)
CG30281NP_726164.1 FReD 63..274 CDD:238040 85/216 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446508
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 1 1.000 - - H122246
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D84222at33392
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
109.900

Return to query results.
Submit another query.