DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Fgl1

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_742007.2 Gene:Fgl1 / 246186 RGDID:620169 Length:314 Species:Rattus norvegicus


Alignment Length:296 Identity:103/296 - (34%)
Similarity:153/296 - (51%) Gaps:47/296 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 VLIKNMKVLRSE-CLNAQ----AEIKSKDIQIQLSAAKIKQMSNELVTQC---SRQDT-CPIDGK 158
            :|.|...||..| ||..|    |:::..:.:::.....|.|:.:|...|.   .::|: ..:.||
  Rat    15 ILGKESWVLGDENCLQEQVRLRAQVRQLETRVKQQQVVIAQLLHEKEVQFLDRGQEDSFIDLGGK 79

  Fly   159 ----------------GGIYKLK-IRELPAFEAPC---SSNGWLTIQKRYDGAENFDRGWKDYKD 203
                            .|.||:| ::.|..|...|   ...||..||:|.||:|||:|||.||::
  Rat    80 RHYADCSEIYNDGFKHSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYEN 144

  Fly   204 GFG---RVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGR 265
            |||   :..||:::|.:.::|:|.|..:.|.|.|...:..:..|.|:.|::|.|...||| ::|.
  Rat   145 GFGNFVQSNGEYWLGNKNINLLTMQGDYTLKIDLTDFEKNSRFAQYEKFKVGDEKSFYEL-NIGE 208

  Fly   266 YNGTAGDSL-----------RPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFY 319
            |:|||||||           ..|:..||:|.|:|||.|..|||.:|..|||:..|..:.|||.:|
  Rat   209 YSGTAGDSLSGTFHPEVQWWASHQTMKFSTRDRDNDNYNGNCAEEEQSGWWFNRCHSANLNGVYY 273

  Fly   320 KEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIRP 355
             :|..|....||::|.:|..  |.|||..|.|.|||
  Rat   274 -QGPYRAETDNGVVWYTWRG--WWYSLKSVVMKIRP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 87/214 (41%)
Fgl1NP_742007.2 FReD 80..306 CDD:238040 85/229 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4104
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.