DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and ANGPTL2

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_036230.1 Gene:ANGPTL2 / 23452 HGNCID:490 Length:493 Species:Homo sapiens


Alignment Length:412 Identity:115/412 - (27%)
Similarity:169/412 - (41%) Gaps:136/412 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LQTRIGHKNEL------LLLQAGQIKDQSARLNV---LIKNMKVLRSECLNAQAE---------- 121
            |:.|: ||.||      ||.|..||:.....:.|   ::..:|:||.|..|..:.          
Human    80 LENRV-HKQELELLNNELLKQKRQIETLQQLVEVDGGIVSEVKLLRKESRNMNSRVTQLYMQLLH 143

  Fly   122 --IKSKDIQIQLS----------------AAKIKQM-------------SNELVTQ----CSRQD 151
              |:.:|..::||                |:|.|.:             .:|::.|    |.|..
Human   144 EIIRKRDNALELSQLENRILNQTADMLQLASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQRVP 208

  Fly   152 TC------PIDGKGGIYK---------------------LKIRELP------------------- 170
            :.      |......:|:                     ||:...|                   
Human   209 SARPVPQPPPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPSSTDKPSG 273

  Fly   171 -------AFE-----------APCSSN--------------GWLTIQKRYDGAENFDRGWKDYKD 203
                   |.|           .|.::|              ||..||:|.||:.||.|.|:.||.
Human   274 PWRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQ 338

  Fly   204 GFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNG 268
            |||.:.||:::|||.::.:|.|..::|.:.:....|....|.|.:|.|..|.|.|:|: ||||:|
Human   339 GFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLR-LGRYHG 402

  Fly   269 TAGDSLRPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGIL 333
            .||||...|..::|||.|:|:|.|..|||..:.|||||..||.|.|||.:|:.|..|:...:|:.
Human   403 NAGDSFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVY 467

  Fly   334 WGSWHNNDWTYSLTFVEMMIRP 355
            |..:...  :|||..|.|||||
Human   468 WAEFRGG--SYSLKKVVMMIRP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 86/268 (32%)
ANGPTL2NP_036230.1 FReD 273..487 CDD:238040 80/216 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.