DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and FGL1

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_004458.3 Gene:FGL1 / 2267 HGNCID:3695 Length:312 Species:Homo sapiens


Alignment Length:280 Identity:103/280 - (36%)
Similarity:147/280 - (52%) Gaps:42/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 ECLNAQAEIKSKDIQIQLSAAKIKQMSNELVTQ--------------CSRQ--DTCPIDGKG--- 159
            |.:..:|:::..:.:::....||||:..|...|              ..||  |...|...|   
Human    29 EQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKL 93

  Fly   160 -GIYKLKIRELPA-FEAPC---SSNGWLTIQKRYDGAENFDRGWKDYKDGFG---RVRGEFFIGL 216
             |.||:|..:.|| |...|   ...||..||:|.||:|||:||||||::|||   :..||:::|.
Human    94 SGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGN 158

  Fly   217 EKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAGDSL------- 274
            :.:|.:|.|..:.|.|.|...:..:.:|.|.||::|.|...||| ::|.|:|||||||       
Human   159 KNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYEL-NIGEYSGTAGDSLAGNFHPE 222

  Fly   275 ----RPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWG 335
                ..|:|.||:|.|:|:|.|..|||.::..|||:..|..:.|||.:| .|.......|||:|.
Human   223 VQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYY-SGPYTAKTDNGIVWY 286

  Fly   336 SWHNNDWTYSLTFVEMMIRP 355
            :||.  |.|||..|.|.|||
Human   287 TWHG--WWYSLKSVVMKIRP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 90/214 (42%)
FGL1NP_004458.3 FReD 78..304 CDD:238040 93/229 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4150
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16943
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.