DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and FGB

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_005132.2 Gene:FGB / 2244 HGNCID:3662 Length:491 Species:Homo sapiens


Alignment Length:385 Identity:106/385 - (27%)
Similarity:172/385 - (44%) Gaps:95/385 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RPILDRFAKVNSSDELKNQVNAMSET----------IKDL----QTRIGHKNELLLLQAGQIK-- 95
            |||.      ||.|||.|.|.|:|:|          :|||    |.::.....::...:.:::  
Human   121 RPIR------NSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKH 179

  Fly    96 ----DQSARLNVLIKNMKVLRSECLNAQAEIK--SKDIQIQLSAAKIKQMSNELVTQCSRQDTCP 154
                |::...|: ..|::||||...|.:::|:  ..|:..|:...:         |.|:.....|
Human   180 QLYIDETVNSNI-PTNLRVLRSILENLRSKIQKLESDVSAQMEYCR---------TPCTVSCNIP 234

  Fly   155 IDG---------KGG----IYKLK-IRELPAFEAPCSSN----GWLTIQKRYDGAENFDRGWKDY 201
            :..         |||    :|.:: ...:..:...|..|    ||..||.|.||:.:|.|.|..|
Human   235 VVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPY 299

  Fly   202 KDGFGRVR------------GEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGE 254
            |.|||.|.            ||:::|.:|:..:||....||.|::....|....|||..|.:..|
Human   300 KQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNE 364

  Fly   255 IESYELKSLGRYNGTAGDSLRP--------------HERQKFTTNDKDNDAY-----RFNCAADE 300
            ...|:: |:.:|.||||::|..              |....|:|.|:|||.:     |..|:.::
Human   365 ANKYQI-SVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKED 428

  Fly   301 YGGWWYYDCAKSMLNGKFYKEGR-----SRNGKTNGILWGSWHNNDWTYSLTFVEMMIRP 355
            .|||||..|..:..||::|..|:     :::|..:|::|.:| ...| ||:..:.|.|||
Human   429 GGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNW-KGSW-YSMRKMSMKIRP 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 73/241 (30%)
FGBNP_005132.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..75
Beta-chain polymerization, binding distal domain of another fibrin 45..47
Fib_alpha 92..234 CDD:312286 30/128 (23%)
FReD 237..486 CDD:294064 73/251 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4150
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.