| Sequence 1: | NP_573254.1 | Gene: | CG6788 / 32773 | FlyBaseID: | FBgn0030880 | Length: | 358 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001994.2 | Gene: | FCN1 / 2219 | HGNCID: | 3623 | Length: | 326 | Species: | Homo sapiens |
| Alignment Length: | 204 | Identity: | 74/204 - (36%) |
|---|---|---|---|
| Similarity: | 100/204 - (49%) | Gaps: | 25/204 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 153 CPIDGKGGIYKLKIRELPAFEAPCSSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLE 217
Fly 218 KVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRY-NGTAGDSLRPHERQK 281
Fly 282 FTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSL 346
Fly 347 TFVEMMIRP 355 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6788 | NP_573254.1 | FReD | 160..356 | CDD:238040 | 71/197 (36%) |
| FCN1 | NP_001994.2 | Collagen | 51..107 | CDD:189968 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 72..111 | ||||
| FReD | 115..325 | CDD:238040 | 72/202 (36%) | ||
| A domain, contributes to trimerization | 115..154 | 4/26 (15%) | |||
| B domain, contributes to trimerization | 155..243 | 33/88 (38%) | |||
| Carbohydrate-binding. /evidence=ECO:0000269|PubMed:17897951 | 282..284 | 1/1 (100%) | |||
| P domain. /evidence=ECO:0000303|PubMed:17148457 | 317..326 | 4/11 (36%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000029 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X25 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.810 | |||||