DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and T15B7.1

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_504743.3 Gene:T15B7.1 / 188512 WormBaseID:WBGene00020516 Length:372 Species:Caenorhabditis elegans


Alignment Length:193 Identity:58/193 - (30%)
Similarity:92/193 - (47%) Gaps:23/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 GWLTIQKRYDGAENF-DRGWKDYKDGFGRV--RGEFFIGLEKVHLMTRQRRHELYIKL-GKIDGT 240
            ||:..|.|:|.:|:: ||.|.:||:|||.|  ...|::|.|.:|:||..::..|.::: |.....
 Worm   181 GWVLFQNRFDDSESYWDRKWDEYKNGFGDVDENSNFWLGNEALHVMTTNKKVTLRVEMYGDRTPN 245

  Fly   241 TSHA------HYDNFELGGEIESYELKSL--------GRYNGTAGDSLRPHERQKFTTNDKDNDA 291
            :.:|      ||.:|::|.:.::|.|..|        |..: ||...|.......|:|.|..:|.
 Worm   246 SKNATDFWFGHYFDFQVGSKTQNYPLLDLTMDWANPIGNAS-TAWYDLTCSIGSPFSTIDNIHDP 309

  Fly   292 YRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIR 354
            .:......:.||||..:||.|.|||. |......||  .|:.| .|..:|.........|::|
 Worm   310 VKECVTKFQMGGWWLKNCALSTLNGA-YTPKDWNNG--YGMFW-IWDGSDTILHPKKTRMLLR 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 58/193 (30%)
T15B7.1NP_504743.3 CLECT 21..138 CDD:214480
FReD 144..368 CDD:294064 57/191 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16943
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.080

Return to query results.
Submit another query.