DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Angptl2

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_598253.2 Gene:Angptl2 / 171100 RGDID:620004 Length:493 Species:Rattus norvegicus


Alignment Length:488 Identity:127/488 - (26%)
Similarity:194/488 - (39%) Gaps:157/488 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSLSISTSLANDPQRSFDQNADNPCSAHRIWVWRPILDRFAKVNSSDE-------LKNQ------ 65
            |.|..:...|..|:...:...|   .:.|.:::   |:|:.:...|.:       :..|      
  Rat    11 LGLLATVGAATGPEADVEGAED---GSQREYIY---LNRYKRAGESPDKCTYTFIVPQQRVTGAI 69

  Fly    66 -VNAMSETIKDLQTRIGHKNEL------LLLQAGQIKDQSARLNV---LIKNMKVLRSECLNAQA 120
             ||:....: .|:.|: ||.||      ||.|..||:.....:.|   ::..:|:||.|..|..:
  Rat    70 CVNSKEPEV-HLENRV-HKQELELLNNELLKQKRQIETLQQLVEVDGGIVSEVKLLRKESRNMNS 132

  Fly   121 E------------IKSKDIQIQLS----------------AAKIKQM-------------SNELV 144
            .            |:.:|..::||                |:|.|.:             .:|::
  Rat   133 RVTQLYMQLLHEIIRKRDNALELSQLENRILNQTADMLQLASKYKDLEHKFQHLAMLAHNQSEVI 197

  Fly   145 TQ----CSRQDTC------PIDGKGGIYK---------------------LKI--RELPAFEA-- 174
            .|    |.|....      |......:|:                     ||:  ..||...|  
  Rat   198 AQLEEHCQRVPAARPVPQPPPATPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPSLPTMPALT 262

  Fly   175 --PCSSN---------------------------------------------GWLTIQKRYDGAE 192
              |.|::                                             ||..||:|.||:.
  Rat   263 SLPSSTDKPSGPWRDCLQALEDGHSTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSV 327

  Fly   193 NFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIES 257
            ||.|.|:.||.|||.:.||:::|||.::.:|.|..::|.:.:....|....|.|.:|.|..|.|.
  Rat   328 NFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEY 392

  Fly   258 YELKSLGRYNGTAGDSLRPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEG 322
            |:|: ||||:|.||||...|..::|||.|:|:|.|..|||..:.|||||..||.|.|||.:|:.|
  Rat   393 YKLR-LGRYHGNAGDSFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGG 456

  Fly   323 RSRNGKTNGILWGSWHNNDWTYSLTFVEMMIRP 355
            ..|:...:|:.|..:...  :|||..|.|||||
  Rat   457 HYRSRYQDGVYWAEFRGG--SYSLKKVVMMIRP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 86/268 (32%)
Angptl2NP_598253.2 t_SNARE 156..>206 CDD:197699 7/49 (14%)
FReD 273..487 CDD:238040 76/216 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.