DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Fgl2

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_032039.2 Gene:Fgl2 / 14190 MGIID:103266 Length:432 Species:Mus musculus


Alignment Length:325 Identity:111/325 - (34%)
Similarity:164/325 - (50%) Gaps:50/325 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 ELKNQVNAMSETIKDLQTRI----GHKNELLLLQAGQIK----DQSARLNVLIKNMKVLRSECLN 117
            ||::|||.:|..:|:.:.:|    |....|.|:....|:    ::.|.|.|::.::....|:| .
Mouse   125 ELESQVNKLSSELKNAKDQIQGLQGRLETLHLVNMNNIENYVDNKVANLTVVVNSLDGKCSKC-P 188

  Fly   118 AQAEIKSKDIQIQLSAAKIKQMSNELVTQCSRQDTCPIDGKGGIYKLKIRELP-----AFEAPCS 177
            :|..::|:.:|..:    .|..|:..|  ..|:.:       |.|    |..|     :||..|.
Mouse   189 SQEHMQSQPVQHLI----YKDCSDHYV--LGRRSS-------GAY----RVTPDHRNSSFEVYCD 236

  Fly   178 ----SNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKID 238
                ..||..:|.|.||:.||.|.|||||.|||.:..||::|.:|:||:|:.:...|.|.|...:
Mouse   237 METMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFN 301

  Fly   239 GTTSHAHYDNFELGGEIESYELKSLGRYNGTAGDSLR-----PHERQKFTTNDKDNDAY-RFNCA 297
            |.|.:|.||.|.:..|...|.| .:|.|||||||:||     .|:.:.|||.|:|||.| ..||.
Mouse   302 GLTLYALYDQFYVANEFLKYRL-HIGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCG 365

  Fly   298 ADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWT----YSLTF--VEMMIRPR 356
            .....|||:..|..:.||||:|.:  ...|..|||.||:|...:..    |..:|  .:|||||:
Mouse   366 LYYSSGWWFDSCLSANLNGKYYHQ--KYKGVRNGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPK 428

  Fly   357  356
            Mouse   429  428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 86/216 (40%)
Fgl2NP_032039.2 Uds1 72..151 CDD:292096 9/25 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Fibrinogen_C 202..428 CDD:278572 90/245 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4167
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.