DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Fga

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001104518.1 Gene:Fga / 14161 MGIID:1316726 Length:789 Species:Mus musculus


Alignment Length:386 Identity:107/386 - (27%)
Similarity:159/386 - (41%) Gaps:96/386 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DPQRSFDQNADNPCSAHRIWVWRPILDRFAKVNSSDELKNQVNAMSETIKDLQTRIGHKNELLLL 89
            |...||..:.|.....|      |.|..|        ..|....:|...|:..::....:::|. 
Mouse   445 DISHSFSGSLDELSERH------PDLSGF--------FDNHFGLISPNFKEFGSKTHSDSDILT- 494

  Fly    90 QAGQIKDQSARLNVLIKNMKVLRSECLNAQAEIKSKDIQIQLSAAKIKQMSNELVTQCSRQ---- 150
               .|:|.|:.:                .:....||...::....|..:|::|..::..|:    
Mouse   495 ---NIEDPSSHV----------------PEFSSSSKTSTVKKQVTKTYKMADEAGSEAHREGETR 540

  Fly   151 -------------------DTCPIDGKGGIYKLKIRELP-----AFEAPC----SSNGWLTIQKR 187
                               .|.....:.||:.:|    |     .|...|    |..|||.||:|
Mouse   541 NTKRGRARARPTRDCDDVLQTQTSGAQNGIFSIK----PPGSSKVFSVYCDQETSLGGWLLIQQR 601

  Fly   188 YDGAENFDRGWKDYKDGFGRV----RGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDN 248
            .||:.||:|.|:|||.|||.:    .|||::|.:.:||:| .|...|.::|....|..::|.| :
Mouse   602 MDGSLNFNRTWQDYKRGFGSLNDKGEGEFWLGNDYLHLLT-LRGSVLRVELEDWAGKEAYAEY-H 664

  Fly   249 FELGGEIESYELKSLGRYNGTAGDSL-----------RPHERQKFTTNDKDNDAYRFNCAADEYG 302
            |.:|.|.|.|.|: :..|.|||||:|           ..|...:|:|.|:|.|.:..|||....|
Mouse   665 FRVGSEAEGYALQ-VSSYRGTAGDALVQGSVEEGTEYTSHSNMQFSTFDRDADQWEENCAEVYGG 728

  Fly   303 GWWYYDCAKSMLNGKFYKEGR--SRNGK----TNGILWGSWHNNDWTYSLTFVEMMIRPRI 357
            ||||..|..:.|||.:|..|.  .||..    .||::|..:...|  |||..|.|.|||.:
Mouse   729 GWWYNSCQAANLNGIYYPGGTYDPRNNSPYEIENGVVWVPFRGAD--YSLRAVRMKIRPLV 787

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 84/225 (37%)
FgaNP_001104518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..420
Fibrinogen_aC 392..457 CDD:288972 4/11 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 526..555 2/28 (7%)
FReD 550..786 CDD:238040 85/244 (35%)
Fib_alpha 51..190 CDD:285864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.