DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Fcna

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_032021.1 Gene:Fcna / 14133 MGIID:1340905 Length:334 Species:Mus musculus


Alignment Length:203 Identity:79/203 - (38%)
Similarity:111/203 - (54%) Gaps:25/203 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 CPIDGKGGIYKLKIRELPAFEAPCSSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLE 217
            |.:|..||                   ||...|:|.||:.:|.|.|..||.|||.:..||::|.:
Mouse   154 CDMDVDGG-------------------GWTVFQRRVDGSIDFFRDWDSYKRGFGNLGTEFWLGND 199

  Fly   218 KVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRY-NGTAGDSLRPHERQK 281
            .:||:|.....||.:.|....|..|:|.|.:|::..|.|.|:| :||:: .|||||||..|....
Mouse   200 YLHLLTANGNQELRVDLQDFQGKGSYAKYSSFQVSEEQEKYKL-TLGQFLEGTAGDSLTKHNNMS 263

  Fly   282 FTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSL 346
            |||:|:||||...||||..:|.|||::|.:|.|||: |..| |.....:||.||:...:.::|.:
Mouse   264 FTTHDQDNDANSMNCAALFHGAWWYHNCHQSNLNGR-YLSG-SHESYADGINWGTGQGHHYSYKV 326

  Fly   347 TFVEMMIR 354
              .||.||
Mouse   327 --AEMKIR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 76/196 (39%)
FcnaNP_032021.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..117
Collagen 65..106 CDD:189968
FReD 123..332 CDD:238040 77/201 (38%)
A domain, contributes to trimerization. /evidence=ECO:0000250 123..162 4/26 (15%)
B domain, contributes to trimerization. /evidence=ECO:0000250 163..251 33/88 (38%)
Carbohydrate-binding. /evidence=ECO:0000250|UniProtKB:O00602 290..292 0/1 (0%)
P domain. /evidence=ECO:0000250|UniProtKB:O00602 325..334 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16943
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.