DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and angptl3

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_571893.2 Gene:angptl3 / 114421 ZFINID:ZDB-GENE-010817-3 Length:466 Species:Danio rerio


Alignment Length:368 Identity:97/368 - (26%)
Similarity:166/368 - (45%) Gaps:82/368 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FAKVNSSD------ELKNQVNAMSETIKDLQTRIGHKNELL------LLQAGQIKDQSARLNVLI 105
            |.|.|:.:      |:.:::|.:.:....|.|::|...|.|      ::...|:::.:|..:|:.
Zfish   111 FLKANNEEIRNLSLEINSKINNILQERSQLHTKVGGLEEKLKGLSQSMMPLEQLQEITALKDVIE 175

  Fly   106 KNMK----VLRSECLNAQAEIKSKDIQIQLSAAKIKQMSNELVTQCSRQDTC--PID-------- 156
            ...:    :|||        :|.:..|:.....|||.:.:: |...:.|||.  |:|        
Zfish   176 TQERTITDLLRS--------VKEQHDQLNYQKIKIKSLEDK-VNYDTFQDTIEKPMDLNPETPDP 231

  Fly   157 ----------------------------GK--GGIYKLKIRELPAFEAPC--SSNGWLT-IQKRY 188
                                        |:  .|||.:|..:...|...|  :.:|..| ||:|.
Zfish   232 FRYLTTNSTNGTKDINDFPADCSEVFTRGQKTSGIYPIKPNQSEPFYVYCEITPDGAATVIQRRE 296

  Fly   189 DGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGG 253
            ||:.:||:.|:.|:.|||::..||::||.|:|.:.:|..:.|:|:|...........| .|.|.|
Zfish   297 DGSVDFDQSWEKYEHGFGKLEKEFWLGLAKIHSIAQQGEYILHIELEDWKEEKRFIEY-TFTLEG 360

  Fly   254 EIESYELKSLGRYNGTAGDSLRPHERQKFTTNDKDNDAY-RFNCAADEYGGWWYYDCAKSMLNGK 317
            ....|.| .|...:|...|::..|...||:|.|:|||.: ..|||.:..||||:..|..:.|||:
Zfish   361 PASDYAL-HLAPLSGDLSDAMSNHTGMKFSTKDRDNDNHDESNCARNYTGGWWFDACGDTNLNGR 424

  Fly   318 F-YKEGRSRNGKTNGILW----GSWHNNDWTYSLTFVEMMIRP 355
            : :...::|:.:..||.|    ||      :|:|...::.|||
Zfish   425 YAWMRSKARHQRRKGIYWRPSKGS------SYTLKSTKITIRP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 69/205 (34%)
angptl3NP_571893.2 SMC_N <111..>209 CDD:330553 21/106 (20%)
FReD 248..461 CDD:238040 68/220 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4328
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.