DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and angpt2b

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_571889.1 Gene:angpt2b / 114408 ZFINID:ZDB-GENE-010817-2 Length:489 Species:Danio rerio


Alignment Length:385 Identity:107/385 - (27%)
Similarity:173/385 - (44%) Gaps:63/385 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSISTSLANDPQRSFDQNADNPCSAHRIWVWRPILDRFAKVN--------SSDELKNQVNAMSET 72
            |.|.|:|       ..|:|:|.|....  |...:|::.:::.        |::.|:.|:...::.
Zfish   120 LEIGTNL-------LSQSAENTCKLTD--VETQVLNQTSRLEIQLLEYSLSTNRLEKQLLEQTQE 175

  Fly    73 IKDLQTRIGHKNELLLLQAGQIKDQSARLNVLIKNMKVLRSECLNAQAEIKS-----------KD 126
            :    :|:..||..:..:...::.:.:|....|:..|....|.|:.|.|:.|           ..
Zfish   176 V----SRLNDKNSYMEQRFADMEAKHSRELQAIQQEKQQLLELLDRQNELVSLLEGELASSTRNS 236

  Fly   127 IQIQLSAAKIKQMSNEL---VTQCSRQDTCPID-----------------GKGGIYKLKI----R 167
            ..||...|.:.....:|   ||.|:...| |:|                 .:.|||.:.:    :
Zfish   237 TLIQRQQASLTDTVQQLLAMVTHCNDIST-PVDKEMLKFRDCAEIFKSGVTENGIYSIHLPNSTQ 300

  Fly   168 ELPAF-EAPCSSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELY 231
            ::..| :......||...|.||||:.:|:|.|.|||.|||...||.::|.:.:||:|..:.:.|.
Zfish   301 KIKVFCDMKTKGGGWTVFQHRYDGSVDFNRDWNDYKLGFGDPSGEHWLGNDVIHLLTTTKDYTLQ 365

  Fly   232 IKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAG-DSLRPHERQKFTTNDKDNDAYRFN 295
            :.|...:...:::.||.|.:.||.:.|.|.:.| ::|||| .|...|...:|:|.|:|||.....
Zfish   366 VHLKDAEEHQAYSQYDTFYIDGEDKKYSLHARG-FSGTAGRTSSLTHSGTQFSTKDQDNDQCSCK 429

  Fly   296 CAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIRP 355
            ||....||||:..|..|.|||.:| .|.|...:.|.|.|..|....|..::|  .|||||
Zfish   430 CAQMATGGWWFEACGPSNLNGIYY-SGNSNVIRYNSIKWYYWKGPSWMATMT--TMMIRP 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 73/202 (36%)
angpt2bNP_571889.1 NYD-SP28 164..244 CDD:291438 15/83 (18%)
FReD 274..487 CDD:238040 73/217 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16943
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.