DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and angpt1

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_571888.1 Gene:angpt1 / 114407 ZFINID:ZDB-GENE-010817-1 Length:513 Species:Danio rerio


Alignment Length:369 Identity:104/369 - (28%)
Similarity:168/369 - (45%) Gaps:51/369 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ISTSLANDPQRSFDQNADNPCSAHRIWVWRPILDR--FAKVNSSDELKNQVNAMSETIKDLQTRI 80
            :.|.:.|...|...|..:|..|.::       |::  ..::|..:::.::...:.|.:::|:.| 
Zfish   159 VETQVLNQTSRLEIQLLENSLSTNK-------LEKQLMIQINEINKIHDKNGFLEEKMQELEDR- 215

  Fly    81 GHKNELLLLQAGQIKDQSARLNVLIKNMKVLRSECLNAQAEIKSKDIQIQLSAAKIKQMSNELVT 145
             |:.||     ..::.:.:.|..|:.....:..|..|..:........:|.....:.:....|::
Zfish   216 -HRQEL-----ESLRTEKSDLQALVSRQSSVIRELENQLSRATGNSTALQRQQQDLMESMRSLLS 274

  Fly   146 QCSRQDTCPID------------------------GKGGIYKLKIRELPAFEAPC----SSNGWL 182
            .|::.....::                        .|.|:|.:.|......:..|    :..||.
Zfish   275 LCAKDAATAVEPNSTKQADEERKFRDCADLYQAGFQKNGVYTINISPQETKKVYCVMESAGGGWT 339

  Fly   183 TIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYD 247
            .||||.||..:|.:.||:||.|||.|.||.::|.|.||::|.||:|.|.::|...||..:.:.||
Zfish   340 VIQKREDGTVDFQKTWKEYKMGFGSVSGEHWLGNEFVHVLTNQRQHGLRVELSDWDGHQAFSQYD 404

  Fly   248 NFELGGEIESYELKSLGRYNGTAG--DSLRPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCA 310
            :|.:..|.:.|.| .|..::||||  .||..|... |:|.|.|||.....||....|||||..|.
Zfish   405 SFHIDSEKQKYRL-FLKTHSGTAGRQSSLAVHGAD-FSTKDVDNDNCTCKCALMLSGGWWYDACG 467

  Fly   311 KSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIR 354
            .|.|||.:|::|: ..||.|||.|..:...  :|||....||||
Zfish   468 PSNLNGVYYRQGQ-HVGKFNGIKWHYFKGP--SYSLRSTVMMIR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 82/201 (41%)
angpt1NP_571888.1 RILP-like <206..272 CDD:304877 11/72 (15%)
FReD 298..508 CDD:238040 81/214 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16943
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.