DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Fcnb

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_446086.1 Gene:Fcnb / 114091 RGDID:621222 Length:319 Species:Rattus norvegicus


Alignment Length:203 Identity:76/203 - (37%)
Similarity:103/203 - (50%) Gaps:25/203 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 CPIDGKGGIYKLKIRELPAFEAPCSSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLE 217
            |.:|..||                   ||...|:|.||..:|.|.|..||.|||...|||::|.:
  Rat   139 CDMDTDGG-------------------GWTVFQRRIDGTVDFFRDWTSYKQGFGSQLGEFWLGND 184

  Fly   218 KVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRY-NGTAGDSLRPHERQK 281
            .:|.:|.|..:||.:.|...||....|.|.:|::.||.|.|:| .||.: .|.|||||.......
  Rat   185 NIHALTTQGTNELRVDLADFDGNHDFAKYSSFQIQGEAEKYKL-ILGNFLGGGAGDSLTSQNNML 248

  Fly   282 FTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSL 346
            |:|.|:|||....|||...:|.|||.||..|.||| .|..|..:: ..||:.|.||...:::|.:
  Rat   249 FSTKDQDNDQGSSNCAVRYHGAWWYSDCHTSNLNG-LYLRGLHKS-YANGVNWKSWKGYNYSYKV 311

  Fly   347 TFVEMMIR 354
            :  ||.:|
  Rat   312 S--EMKVR 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 73/196 (37%)
FcnbNP_446086.1 Collagen 45..100 CDD:189968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..106
FReD 108..317 CDD:238040 75/201 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.