DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and LOC108179162

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_017211437.2 Gene:LOC108179162 / 108179162 -ID:- Length:243 Species:Danio rerio


Alignment Length:210 Identity:74/210 - (35%)
Similarity:110/210 - (52%) Gaps:19/210 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 GIYKLKIRELPAFEAP----C---------SSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGE 211
            |||.:    .||.:.|    |         .:.||...|:|.||..||.:.|::||.|||...||
Zfish    39 GIYSI----YPAGDIPVWVYCQMISDGKDEENGGWTVFQRRMDGRINFYQPWEEYKRGFGTTEGE 99

  Fly   212 FFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAGDSLRP 276
            :::|||.::.:||.::..|.:.|...:|....|.|.:|.:|.|.|.|.|:..|..:|.|||||..
Zfish   100 YWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGSEAEGYRLQVSGFTDGGAGDSLTD 164

  Fly   277 HERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNND 341
            |..|||:|.|||.|||..|||.:..|.:|:..|..:..|| .|..|........|::|.:| .:.
Zfish   165 HNDQKFSTFDKDQDAYGDNCAQEFLGAFWFKYCHNTNPNG-VYLWGEDDTHFGIGVVWSTW-KDS 227

  Fly   342 WTYSLTFVEMMIRPR 356
            :|.|:..:.:||:.:
Zfish   228 FTVSMKSLSLMIKSK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 74/208 (36%)
LOC108179162XP_017211437.2 FReD 24..242 CDD:238040 74/208 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.