DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and LOC105947509

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_031760299.1 Gene:LOC105947509 / 105947509 -ID:- Length:304 Species:Xenopus tropicalis


Alignment Length:245 Identity:84/245 - (34%)
Similarity:113/245 - (46%) Gaps:42/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 TQCSRQDTCPI--------DGKGGIYKL----KIREL--------------PAFEAP----C--- 176
            |:..|.||.|:        .|..|:|.|    ..::|              |...:|    |   
 Frog    64 TKGERGDTGPMGLPGQKGDPGDAGLYSLYNGTSCKDLLNQGEYLSGWNIITPVGMSPLRVLCDMH 128

  Fly   177 -SSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGT 240
             ...|||..|:|:||..:|:..|..||.|||....||::|.:.::.:|.....||.|.|...|..
 Frog   129 TDGGGWLVFQRRWDGTVSFNVDWNTYKRGFGSEMNEFWLGNDILYNLTSSGTWELRIDLRDFDNN 193

  Fly   241 TSHAHYDNFELGGEIESYELKSLGRYN-GTAGDSLRPHERQKFTTNDKDNDAYRFNCAADEYGGW 304
            ..:|.|..|::.||..:|.| .||.|| |..||||.||....|:|.|:||:....|||.|..|||
 Frog   194 MYYAKYSFFQILGEDNNYTL-LLGSYNEGNIGDSLTPHNTVPFSTYDRDNNFLLENCAFDNQGGW 257

  Fly   305 WYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIR 354
            ||.:|.:|.|||.:    |.......||.|.|...|.::|..:  ||.||
 Frog   258 WYNNCYQSNLNGLY----RLVQNNETGINWLSDGRNHYSYKSS--EMKIR 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 78/222 (35%)
LOC105947509XP_031760299.1 Collagen <65..88 CDD:396114 5/22 (23%)
FReD 93..303 CDD:238040 75/216 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.