DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and si:zfos-2330d3.6

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_009294456.1 Gene:si:zfos-2330d3.6 / 103909555 ZFINID:ZDB-GENE-110411-23 Length:242 Species:Danio rerio


Alignment Length:214 Identity:80/214 - (37%)
Similarity:111/214 - (51%) Gaps:21/214 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 GK--GGIYKLKIRELPAFEAPCS-------------SNGWLTIQKRYDGAENFDRGWKDYKDGFG 206
            ||  .|:|.:    .||...|.|             :.||...|:|.||:.||.|.|::||.|||
Zfish    33 GKTLSGVYSI----YPAGNIPASVYCQMISSGKGGENGGWTVFQRRMDGSVNFFRPWEEYKRGFG 93

  Fly   207 RVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAG 271
            .|.||:::|||.::.:||.::..|.:.|...:|....|.|.:|.:|.|.|.|:|:..|..||.||
Zfish    94 NVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRKGFAQYSSFSVGSEAEGYKLQVSGFTNGGAG 158

  Fly   272 DSLRPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGS 336
            |||..|...||||.|||.|.:..|||....|.:||.||..:..|| .|..|..:.....|.:|.:
Zfish   159 DSLIYHSGMKFTTYDKDQDTHTQNCARIYVGAFWYKDCHNANPNG-VYLGGEDKTLFAIGNVWYT 222

  Fly   337 WHNNDWTYSLTFVEMMIRP 355
            |.|| :...:.|:.|.|:|
Zfish   223 WKNN-FEIGMKFITMKIKP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 78/209 (37%)
si:zfos-2330d3.6XP_009294456.1 FReD 23..241 CDD:238040 80/214 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.