DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and ANGPTL7

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_066969.1 Gene:ANGPTL7 / 10218 HGNCID:24078 Length:346 Species:Homo sapiens


Alignment Length:337 Identity:114/337 - (33%)
Similarity:168/337 - (49%) Gaps:37/337 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 AHRIWVWR------PILDRFAKVNSSDELKNQVNAMSETIKDLQTRIGHKNE----LLLLQAGQI 94
            :|..|:.:      |...:....|..:|:| ::.|....:..|.:.:..|.|    .:::|..::
Human    21 SHPAWLQKLSKHKTPAQPQLKAANCCEEVK-ELKAQVANLSSLLSELNKKQERDWVSVVMQVMEL 84

  Fly    95 KDQSARLNVLIKNMKVLRSECLNAQAEIKSKDIQIQLSAAK-IKQMSNELVTQCSR--QDTCPID 156
            :..|.|:...:.:.:...|| :|.|.:|      :||.||: :.|.|.:.:..||.  |....| 
Human    85 ESNSKRMESRLTDAESKYSE-MNNQIDI------MQLQAAQTVTQTSADAIYDCSSLYQKNYRI- 141

  Fly   157 GKGGIYKLKIREL---PAFEAPC----SSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFI 214
              .|:|||...:.   |..|..|    |..||..||:|..|..:|.|.||.||.|||.:||:|::
Human   142 --SGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWL 204

  Fly   215 GLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAG-DSLRPHE 278
            |.|.:|.::||.. .|.:::...:|...:|.|.:|.||.|:.||.| .||.|.|..| |:|:.|.
Human   205 GNEHIHRLSRQPT-RLRVEMEDWEGNLRYAEYSHFVLGNELNSYRL-FLGNYTGNVGNDALQYHN 267

  Fly   279 RQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWT 343
            ...|:|.|||||.....||....||:||..|..|.|||.:|:.| ..|...:||.|..||.:  |
Human   268 NTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLG-EHNKHLDGITWYGWHGS--T 329

  Fly   344 YSLTFVEMMIRP 355
            |||..|||.|||
Human   330 YSLKRVEMKIRP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 86/204 (42%)
ANGPTL7NP_066969.1 SMC_N <37..>109 CDD:330553 13/73 (18%)
FReD 129..341 CDD:238040 88/219 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.