DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and si:ch211-157b11.8

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_009300879.1 Gene:si:ch211-157b11.8 / 101884863 ZFINID:ZDB-GENE-131127-436 Length:392 Species:Danio rerio


Alignment Length:380 Identity:108/380 - (28%)
Similarity:174/380 - (45%) Gaps:73/380 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RIWVWRPIL------------------DRFAKVNSSDELKN--QVNAMSETIKDLQTRIGHKNEL 86
            |:|..|.||                  .:.:::..:.|.:.  ||...||.:..|| |...::|.
Zfish    19 RVWCQRDILVAGPPNSATSAPKIHQPHSQDSRLRKTPENRKHAQVTDTSERLIQLQ-RCMLQHES 82

  Fly    87 LLLQAGQIKDQSARLNVLIKNMKVLRSEC-LNAQAEIKSKDIQIQLSAAKIKQMSNEL------V 144
            :.:..|   |.|..|...:..|..:.:|| |:..:: :.:::..:|.:...|....:|      :
Zfish    83 VAMSRG---DGSDSLVAFLALMAAVLTECNLHCHSQ-RLREMATRLESVVGKNGEKDLLLLLKSI 143

  Fly   145 TQCSRQDTCP----IDGKGG--------IYKLKIRE-----------LPAFEAPC----SSNGWL 182
            |........|    :....|        ||:|.|:|           .||.||.|    :..||.
Zfish   144 THSKPNSLKPRTPTVPPSAGLYPQDCHEIYQLGIKENGIYTIQPDPKQPALEAVCDMVSAGGGWT 208

  Fly   183 TIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYD 247
            ..|:|:||..:|:|.|::|:||||..:.|.::|...::.:|...:|.|.|.|......|.||:|:
Zfish   209 VFQRRFDGKTDFNRTWQEYRDGFGSPQTEHWLGNAVLYALTANGQHTLRITLQDWHEQTRHANYN 273

  Fly   248 NFELGGEIESYELKSLGRYNGTAGDSLR-----PHERQKFTTNDKDNDAYRF-NCAADEYGGWWY 306
            ||::.||.:.:.| :...|:|.||::..     .|:.:.|:|.|:|:|.|.. |||.....|||:
Zfish   274 NFKVAGENQRFRL-TAREYHGDAGNAFSYSKQYNHDGRAFSTYDRDHDRYAAGNCARYYGAGWWF 337

  Fly   307 YDCAKSMLNGKFYKEGRSRNGKTNGILWGSW-----HNNDWTYSLTFVEMMIRPR 356
            ..|..:.|||:|| .|| .:|.|:||.||:|     :.....||...|||..|||
Zfish   338 DSCLAANLNGRFY-HGR-YSGITDGIYWGTWYILTEYRTGERYSFKSVEMKTRPR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 79/229 (34%)
si:ch211-157b11.8XP_009300879.1 FReD 165..390 CDD:238040 78/227 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.