DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and fcn2l

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_004917606.2 Gene:fcn2l / 101735093 XenbaseID:XB-GENE-22167163 Length:301 Species:Xenopus tropicalis


Alignment Length:199 Identity:71/199 - (35%)
Similarity:99/199 - (49%) Gaps:14/199 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 GIYKLKIRELPAFEAPCSSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTR 224
            |:..:|:    ..:......||:..|:|:||:.:|.|.||.||.|||....||::|.:.:|.:|.
 Frog   113 GVQPMKV----LCDMHTDGGGWIVFQRRWDGSVDFFRDWKSYKSGFGSRLNEFWLGNDNLHKLTS 173

  Fly   225 QRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAGDSLRPHERQKFTTNDKDN 289
            ....||.:.|...:.....|.|::|.:.||.|.::|.......|...|:::.|....|:|.|:||
 Frog   174 SGTWELRVDLQDFENAKHFAKYESFRILGESEKFKLLIGAMKGGNIEDAMKVHNTMPFSTKDQDN 238

  Fly   290 DAYRFNCAADEY-GGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILW--GSWHNNDWTYSLTFVEM 351
            |....:| ||.| |||||..|..|.||| .|..| |.:....||.|  |..||    ||....||
 Frog   239 DILPEHC-ADRYKGGWWYNGCHHSNLNG-LYLLG-SHSNTAEGINWYGGRGHN----YSYKRSEM 296

  Fly   352 MIRP 355
            .|||
 Frog   297 KIRP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 71/199 (36%)
fcn2lXP_004917606.2 Collagen 38..>79 CDD:396114
FReD 91..300 CDD:238040 69/197 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.