DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and mfap4.8

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_003197840.1 Gene:mfap4.8 / 100538028 ZFINID:ZDB-GENE-121214-168 Length:243 Species:Danio rerio


Alignment Length:210 Identity:73/210 - (34%)
Similarity:111/210 - (52%) Gaps:21/210 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 GIYKLKIRELPAFEAP----C---------SSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGE 211
            |||.:    .||.:.|    |         .:.||...|:|.||:.:|.:.|:.|:.|||...||
Zfish    39 GIYSI----YPAGDTPVWVYCQMVSDGKVEENEGWTVFQRRMDGSIHFFQLWEKYRIGFGTTEGE 99

  Fly   212 FFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAGDSLRP 276
            :::|||.::.:||.::..|.:.|....|....|.|.:|.:|.|:|.|:|:..|..:|.|||||..
Zfish   100 YWLGLENLYQLTRHKKFMLRVDLEDFTGRRGFAQYSSFSVGSEVEGYKLELSGFTDGGAGDSLSY 164

  Fly   277 HERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKF-YKEGRSRNGKTNGILWGSWHNN 340
            |...||:|.|:|.|....|||....|.:||..|..:..||.: :.|.:|:||  ..|.|.:|.|:
Zfish   165 HNGMKFSTYDRDQDTNEDNCARMRLGAFWYKGCNYANPNGVYLWGEDKSKNG--IAINWYTWKND 227

  Fly   341 DWTYSLTFVEMMIRP 355
            :.| .:.|:.|.|:|
Zfish   228 NET-PMKFITMKIKP 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 73/210 (35%)
mfap4.8XP_003197840.1 FReD 24..242 CDD:238040 73/210 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.