DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and LOC100497570

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_017950245.1 Gene:LOC100497570 / 100497570 -ID:- Length:231 Species:Xenopus tropicalis


Alignment Length:207 Identity:68/207 - (32%)
Similarity:102/207 - (49%) Gaps:24/207 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 QDTCPIDGKGGIYKLKIRELPAFEAPCSSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFI 214
            |..|.:|..||                   ||:..|:||||:.:|..||..|:.|||....||::
 Frog    47 QVLCDMDTDGG-------------------GWIVFQRRYDGSVDFYLGWDSYRRGFGSRLTEFWL 92

  Fly   215 GLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRY-NGTAGDSLRPHE 278
            |.:.:..:|.:...:|.:.|...|.|..:|.|..|.:....::|.| ::|.: .|.|||||..|.
 Frog    93 GNDNLSHLTSRGTWDLRVDLRDFDNTAYYAKYSAFRISPASDNYRL-TIGAFLGGNAGDSLTYHN 156

  Fly   279 RQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWT 343
            ...|:|.|:|||.:.:|||.:..|.||:..|..|.|||.:..:   :|....|:||.:.:.:...
 Frog   157 GMAFSTKDRDNDQWVYNCATNWPGAWWFNVCFYSDLNGVYRLQ---QNENPIGVLWPTANTSISR 218

  Fly   344 YSLTFVEMMIRP 355
            ||....||.|||
 Frog   219 YSFKISEMKIRP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 64/197 (32%)
LOC100497570XP_017950245.1 FReD 20..230 CDD:238040 66/205 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.