DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and fgl1b

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_002936775.2 Gene:fgl1b / 100497330 XenbaseID:XB-GENE-5957151 Length:330 Species:Xenopus tropicalis


Alignment Length:310 Identity:99/310 - (31%)
Similarity:143/310 - (46%) Gaps:40/310 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IKDLQTRIGHKNELLLLQAGQIKDQSARLNVLIKNMKVLRSECLNAQAEIKSKDIQIQLSAAKIK 137
            :|||:  |...:.:.|||..|:......|..|     .||....|....:|||..:.....:|::
 Frog    20 LKDLE--ICQIDNIKLLQRIQVLQNQLHLGDL-----HLRDLLGNNYHSLKSKVFKSSSHRSKVE 77

  Fly   138 QM-----SNELVTQCSRQDTCPIDGKG----GIYKLKIR-ELPAFEAPC---SSNGWLTIQKRYD 189
            .:     |..|:..  .:|...:...|    |.|:::.| |...|...|   ...||..||:|.:
 Frog    78 DVLLPTTSGNLIVY--NEDCSSVFESGRKESGYYRVRPRAENEPFLVFCDMSDGGGWTVIQRRSN 140

  Fly   190 GAENFDRGWKDYKDGFGRVRG---EFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFEL 251
            |..||:|.|.:||:|||..:.   |.:||...::.:..:|...|.|.|....|...||.|:.|.|
 Frog   141 GKVNFNRKWDEYKEGFGLFKSRNDEHWIGNNHIYDLLDKREMTLKIDLTDWQGNAKHAIYETFRL 205

  Fly   252 GGEIESYELKSLGRYNGTAGDSL-----------RPHERQKFTTNDKDNDAY-RFNCAADEYGGW 304
            ..|.::|:| .:|.|:|.|||.|           ..|....|:|:|||||.: :.|||.:...||
 Frog   206 TNEQDNYKL-WIGYYSGNAGDGLSGGSNFEQQWSASHSGMPFSTSDKDNDRFIKGNCAKENKCGW 269

  Fly   305 WYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIR 354
            |:..|..:.|||.:||:|.......|||:|..||.. | |||....|.||
 Frog   270 WFNRCHAANLNGVYYKKGNYTGEFDNGIVWSPWHGL-W-YSLKSTAMKIR 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 78/214 (36%)
fgl1bXP_002936775.2 FReD 94..318 CDD:238040 80/227 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.