DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and angptl4

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_002938598.2 Gene:angptl4 / 100492339 XenbaseID:XB-GENE-481750 Length:457 Species:Xenopus tropicalis


Alignment Length:349 Identity:104/349 - (29%)
Similarity:160/349 - (45%) Gaps:65/349 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SDELKNQVNAMSETIKDLQTRI------------------GHKNELLLLQAGQIKDQSARLNVLI 105
            |..||.:|..:|:..:.|:.|:                  ..|.:||.:|. .::.||.|::.|:
 Frog   115 SQGLKGKVQEISKDRQLLEHRLQNMEAKIQLLEPSKRQNRSEKEDLLSIQT-LMEIQSKRIDELL 178

  Fly   106 KNMKVLRSECLNAQAEIKSKDIQIQLSAAKIKQMSNELVTQC--------------SRQDT---- 152
            :.:|:.:.:......:|||....||         ||.|.||.              |...|    
 Frog   179 EKIKLQQYKLDKQNLQIKSLQNTIQ---------SNRLETQTWKMNLKKTVEDEAQSNSSTEEGK 234

  Fly   153 ------CP---IDGK--GGIYKLKIRELPAFEAPC---SSNGWLTIQKRYDGAENFDRGWKDYKD 203
                  |.   ::||  .||:.::......||..|   :..||...|:|.||:.:|||.|..|.|
 Frog   235 HVFPSDCHQIFLEGKKSSGIFSIQPSGAQPFEVYCEMTADAGWTVTQRRTDGSVDFDRLWDAYTD 299

  Fly   204 GFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNG 268
            |||.:.|||::||||:|.:|:|.::.::|.|...:....|.. ..|.|.|..|:|.|:.||...|
 Frog   300 GFGNLNGEFWLGLEKMHQITQQGQYLIHIDLQDWENNVQHME-AKFLLAGSNEAYALQLLGPVTG 363

  Fly   269 TAGDSLRPHERQKFTTNDKDNDAYR-FNCAADEYGGWWYYDCAKSMLNGKFY-KEGRSRNGKTNG 331
            ...::|...::.:|:|.|:|.|... ||||....||||:..|..|.||||:: ...|:|:.:..|
 Frog   364 ELENALSDFQQLQFSTRDRDQDKKSDFNCAKHLSGGWWFSSCGHSNLNGKYFLSVPRARHERKQG 428

  Fly   332 ILWGSWHNNDWTYSLTFVEMMIRP 355
            |.|.:|...  .|.|....:.|||
 Frog   429 IFWKTWKGR--YYPLKSTSIKIRP 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 73/201 (36%)
angptl4XP_002938598.2 Smc <55..>234 CDD:224117 28/128 (22%)
FReD 237..451 CDD:238040 76/217 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.