DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and mfap4.1

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_012826910.1 Gene:mfap4.1 / 100488644 XenbaseID:XB-GENE-997605 Length:256 Species:Xenopus tropicalis


Alignment Length:179 Identity:72/179 - (40%)
Similarity:99/179 - (55%) Gaps:9/179 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 WLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAH 245
            |..||||::|..:|.|||.|||.||||...|:::||..::.:|.:|::||.|.||..:..|.||.
 Frog    80 WTVIQKRFNGTLSFFRGWTDYKLGFGRADEEYWLGLHNIYQLTLRRKYELRIDLGDFENNTVHAK 144

  Fly   246 YDNFEL-----GGEIESYELKSLGRYNGTAGDSLRPHERQKFTTNDKDNDAYRFNCAADEYGGWW 305
            |.:|.|     ..|.:.|.|......:|.|||||..|...||:|.|:|.|.|:.|||:...||:|
 Frog   145 YGDFSLSPKAINPEDDGYTLYVEEFTDGGAGDSLTYHSGMKFSTYDRDRDTYQQNCASLSAGGFW 209

  Fly   306 YYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIR 354
            :..|..:.|||.:.:......|  :||:|..|  ....|||...||.||
 Frog   210 FRACHLANLNGPYLRGAHLSYG--SGIIWSGW--KGLYYSLKSTEMKIR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 72/179 (40%)
mfap4.1XP_012826910.1 FReD 37..256 CDD:238040 72/179 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.