DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and XB5913531

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_012826224.3 Gene:XB5913531 / 100488177 XenbaseID:XB-GENE-5913532 Length:255 Species:Xenopus tropicalis


Alignment Length:199 Identity:70/199 - (35%)
Similarity:110/199 - (55%) Gaps:21/199 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 LPAFEAPCSSNG--WLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELY 231
            ||.: ...::||  |...|||:||:.:|::.|:||..|||....|:::||:.:..:|...|:||.
 Frog    63 LPVY-CDMTTNGMPWTVFQKRFDGSTDFNQNWQDYVMGFGNADYEYWLGLQNIQRLTMTGRYELR 126

  Fly   232 IKLGKIDGTTSHAHYDNFE-----LGGEIESYELKSLGRYNGTAGDSLRPHERQKFTT--NDKDN 289
            ::|...:|...:|.|.||.     |..|.:.|:|...|..:|.|||||..|..|:|:|  ||:.|
 Frog   127 VELENFNGQKVYAFYSNFSLSPQALNAEHDGYKLYVDGFTDGGAGDSLSVHVGQRFSTYDNDQIN 191

  Fly   290 DAYRFNCAADEY--GGWWYYD--CAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVE 350
            |..  |||  ||  ||:|||.  ||.:.||.::......::.: :|..|.:|  .::..:|...:
 Frog   192 DIQ--NCA--EYWGGGFWYYSNGCADAGLNARYINPNTLKSPQ-HGFSWVTW--VEYPETLRASQ 249

  Fly   351 MMIR 354
            ||:|
 Frog   250 MMMR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 70/199 (35%)
XB5913531XP_012826224.3 FReD 33..255 CDD:238040 70/199 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.