DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and fibcd1a

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_005166963.1 Gene:fibcd1a / 100151577 ZFINID:ZDB-GENE-081105-148 Length:464 Species:Danio rerio


Alignment Length:342 Identity:109/342 - (31%)
Similarity:170/342 - (49%) Gaps:58/342 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 ILDRFAKVNS-SDELKNQVNAM-------SETIKDLQTRIGHKNELLLLQAGQIKDQSARLNV-- 103
            :.:..||::: :.:||.:.||:       .:.:..|||..|...:||         ..:::|:  
Zfish   140 LAEEVAKLSAHASQLKMEYNALRQGQGNIGQELSTLQTEQGRLIQLL---------SESQINMVK 195

  Fly   104 LIKNMKVLRSECLNAQAEIKSKDIQIQLSAAKIKQM---------------SNELVTQCSRQDTC 153
            ::.::....|........|||: ::..|..|.::.:               .:::.....|:|  
Zfish   196 VVNSVSDALSSMQKENGNIKSR-LKADLQRAPVRSVRPKGCAAGEGSRPRDCSDIYASGQRED-- 257

  Fly   154 PIDGKGGIYKLKIRELPA-FEAPC----SSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFF 213
                  |||.:.....|| |:..|    ...||..||:|.||:.||.|.|:.|::|||::.||.:
Zfish   258 ------GIYSVFPTHYPAGFQVFCDMTTDGGGWTVIQRREDGSVNFFRDWEAYREGFGKITGEHW 316

  Fly   214 IGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELG-----GEIESYELKSLGRYNGTAGDS 273
            :|::::|.:|.|..:||.|.|...:.:||.|.|.:|.:|     .:.:.|.| |:..|:||||||
Zfish   317 LGMKRIHALTIQANYELRIDLEDFENSTSFAQYGSFGVGLFSVDPDEDGYPL-SIADYSGTAGDS 380

  Fly   274 LRPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWH 338
            |..|...||||.|||||....|||:..:|.|||.:|..|.|||: |..|: .....:||.|.|| 
Zfish   381 LLKHNGMKFTTKDKDNDHSENNCASFYHGAWWYRNCHTSNLNGQ-YLRGQ-HTSYADGIEWSSW- 442

  Fly   339 NNDWTYSLTFVEMMIRP 355
             ..|.|||.|.||.|||
Zfish   443 -TGWQYSLKFTEMKIRP 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 88/206 (43%)
fibcd1aXP_005166963.1 FReD 243..458 CDD:238040 88/227 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122246
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.