Sequence 1: | NP_573254.1 | Gene: | CG6788 / 32773 | FlyBaseID: | FBgn0030880 | Length: | 358 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001107287.1 | Gene: | tnr / 100135076 | XenbaseID: | XB-GENE-948286 | Length: | 1350 | Species: | Xenopus tropicalis |
Alignment Length: | 207 | Identity: | 78/207 - (37%) |
---|---|---|---|
Similarity: | 125/207 - (60%) | Gaps: | 17/207 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 156 DGKGGIYKLKI-----RELPAF-EAPCSSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFI 214
Fly 215 GLEKVHLMTRQRRHELYIKLGKIDGTTS-HAHYDNFELGGEIESYELKSLGRYNGTAGDSLRPHE 278
Fly 279 RQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWT 343
Fly 344 YSLTFVEMMIRP 355 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6788 | NP_573254.1 | FReD | 160..356 | CDD:238040 | 77/203 (38%) |
tnr | NP_001107287.1 | EGF_alliinase | 153..196 | CDD:282688 | |
EGF_2 | 198..223 | CDD:285248 | |||
EGF_2 | 260..285 | CDD:285248 | |||
EGF_2 | 292..316 | CDD:285248 | |||
FN3 | 321..410 | CDD:238020 | |||
fn3 | 413..493 | CDD:278470 | |||
fn3 | 502..582 | CDD:278470 | |||
FN3 | 592..676 | CDD:238020 | |||
fn3 | 684..763 | CDD:278470 | |||
fn3 | 773..840 | CDD:278470 | |||
fn3 | 862..939 | CDD:278470 | |||
fn3 | 949..1018 | CDD:278470 | |||
FN3 | 1037..1122 | CDD:238020 | |||
FReD | 1129..1337 | CDD:238040 | 76/205 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR19143 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |