DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and tnr

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001107287.1 Gene:tnr / 100135076 XenbaseID:XB-GENE-948286 Length:1350 Species:Xenopus tropicalis


Alignment Length:207 Identity:78/207 - (37%)
Similarity:125/207 - (60%) Gaps:17/207 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 DGKGGIYKLKI-----RELPAF-EAPCSSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFI 214
            |.:.|:|.:.|     :.:|.: :....:.||:..|:|.:|..:|.|.|.||:.|||.:..||::
 Frog  1141 DNQSGVYYIYINGDMSQSVPVYCDMATDAGGWIVFQRRQNGLTDFFRKWADYRVGFGNLEDEFWL 1205

  Fly   215 GLEKVHLMTRQRRHELYIKLGKIDGTTS-HAHYDNFELGGEIESYELKSLGRYNGTAGDSLRPHE 278
            ||:.:|.:|.|.|:||.|.:.  ||..: :|:|:.|.:|.....|:|: :|.:|||:||||..|:
 Frog  1206 GLDTLHQVTSQGRYELRIDMR--DGQEAVYAYYNKFNIGDARSLYKLR-IGDFNGTSGDSLTYHQ 1267

  Fly   279 RQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWT 343
            .:.|:|.|:|||....|||:...|.|||.:|.::.||||:   |.||:  :.||.|..|..::  
 Frog  1268 GRPFSTKDRDNDVAVTNCASSYKGAWWYKNCHRTNLNGKY---GESRH--SQGINWYHWKGHE-- 1325

  Fly   344 YSLTFVEMMIRP 355
            :|:.||||.:||
 Frog  1326 FSIPFVEMKMRP 1337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 77/203 (38%)
tnrNP_001107287.1 EGF_alliinase 153..196 CDD:282688
EGF_2 198..223 CDD:285248
EGF_2 260..285 CDD:285248
EGF_2 292..316 CDD:285248
FN3 321..410 CDD:238020
fn3 413..493 CDD:278470
fn3 502..582 CDD:278470
FN3 592..676 CDD:238020
fn3 684..763 CDD:278470
fn3 773..840 CDD:278470
fn3 862..939 CDD:278470
fn3 949..1018 CDD:278470
FN3 1037..1122 CDD:238020
FReD 1129..1337 CDD:238040 76/205 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.