DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and mfap4.4

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001103327.2 Gene:mfap4.4 / 100126131 ZFINID:ZDB-GENE-071004-9 Length:242 Species:Danio rerio


Alignment Length:235 Identity:84/235 - (35%)
Similarity:120/235 - (51%) Gaps:25/235 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 MSNELVTQC--SRQDTCPIDGKG----GIYKLKIRELPAFEAP----C---------SSNGWLTI 184
            :|..|.:.|  .:.|...|...|    |.|.:    .||.::|    |         .:.||..|
Zfish    11 LSAALASDCRFMQFDCSDIYNSGETLSGAYTI----YPAGDSPVWVYCQMVSEGKDEDNGGWTVI 71

  Fly   185 QKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNF 249
            |:|.||:.||.|.|:|||.|||.|.||:::|||.::.:||.::..|.:.|...:|....|.|.:|
Zfish    72 QRRMDGSVNFYRPWRDYKRGFGNVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSF 136

  Fly   250 ELGGEIESYELKSLGRYNGTAGDSLRPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSML 314
            .:|.|.|.|:|:..|..:|.||||:.||...||:|.|||.|.|..|||.:..|.:||..|..:..
Zfish   137 SVGCECEGYKLQVSGFTDGGAGDSMTPHNEMKFSTFDKDQDTYEKNCAKEYLGAFWYGYCHNTNP 201

  Fly   315 NGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIR 354
            ||.:..|..|.:... |:.|.||.|.. ..||.::.|.|:
Zfish   202 NGVYLWEDDSTHFAI-GVTWYSWKNTH-DMSLKYISMKIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 78/208 (38%)
mfap4.4NP_001103327.2 FReD 25..239 CDD:238040 80/219 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.