DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and LOC100007488

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001315007.1 Gene:LOC100007488 / 100007488 -ID:- Length:245 Species:Danio rerio


Alignment Length:234 Identity:80/234 - (34%)
Similarity:112/234 - (47%) Gaps:29/234 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 LVTQCSRQDTCPID---------GKGGIYKLKIRELPAFEAP----C---------SSNGWLTIQ 185
            |...||.....|.|         ...|||.:    .||.:.|    |         ...||..||
Zfish    16 LCCDCSHSVDKPFDCSDIYKSGQNLSGIYSI----YPAGDFPVWVYCQMVSEGKDEDKGGWTVIQ 76

  Fly   186 KRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFE 250
            :|.||:.||.|.|:|||.|||:|.||:::|||.::.:||.::..|.:.|...:|....|.|.:|.
Zfish    77 RRMDGSVNFYRPWRDYKRGFGKVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFS 141

  Fly   251 LGGEIESYELKSLGRYNGTAGDSLRPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLN 315
            :|.|.|.|:|:..|..:|.|||.|..|...||:|.|||.|.:..:||.:..||:||..|..:..|
Zfish   142 VGCECEGYKLQVSGFTDGGAGDCLSGHNDLKFSTFDKDQDTHEKSCAKEYLGGFWYGSCHNTNPN 206

  Fly   316 GKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIR 354
            | .|..|........|:.|.:|.|  :..|:....|.|:
Zfish   207 G-VYLWGEDPTHYAIGVCWSTWKN--YAVSMKTFSMKIK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 75/208 (36%)
LOC100007488NP_001315007.1 FReD 25..244 CDD:238040 77/225 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.