DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and fgl2b

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_001341185.5 Gene:fgl2b / 100001116 ZFINID:ZDB-GENE-120709-53 Length:1447 Species:Danio rerio


Alignment Length:216 Identity:83/216 - (38%)
Similarity:125/216 - (57%) Gaps:21/216 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 KGGIYKL----KIRELPAF-EAPCSSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLE 217
            :.|:|::    |....|.| :...|..||..||.|:||:.:|:|.|.:||:|||::.|||::|.:
Zfish  1230 RNGVYRVTPRPKNTTFPVFCDMASSGGGWTLIQHRFDGSTSFNRTWDEYKNGFGKLIGEFWLGND 1294

  Fly   218 KVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAGDSLR-----PH 277
            |:||:|:.:...|.|::...:|...:|.||:|.:..|.:.|.| |:..|:||||::::     .|
Zfish  1295 KIHLLTKAKNMSLRIEIEDFEGIREYAQYDHFYIANESQQYRL-SIDGYSGTAGNAMQFSKKYNH 1358

  Fly   278 ERQKFTTNDKDNDAY-RFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNND 341
            :::.|||.|:|||.| ..||.|....|||:..|..:.||||:|:.  ...|..|||.||:|||..
Zfish  1359 DQKFFTTPDRDNDQYPSGNCGAYYSSGWWFDACMSANLNGKYYQS--KYKGVRNGIFWGTWHNIT 1421

  Fly   342 WTY-------SLTFVEMMIRP 355
            ..|       |...|.|||||
Zfish  1422 MEYYPTNERQSFRTVRMMIRP 1442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 83/214 (39%)
fgl2bXP_001341185.5 FReD 1219..1442 CDD:238040 81/214 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.