DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mnb and CLK3

DIOPT Version :9

Sequence 1:NP_728107.2 Gene:mnb / 32771 FlyBaseID:FBgn0259168 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_001123500.2 Gene:CLK3 / 1198 HGNCID:2071 Length:490 Species:Homo sapiens


Alignment Length:466 Identity:137/466 - (29%)
Similarity:212/466 - (45%) Gaps:90/466 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 QRHAPLYGRFVDAEDLPATHRDVMHHHSSPSSSSEVRAMQARIPNHFREPASGPLRKLSVDLIKT 246
            :..:|.:|     ||           :..||.|...|..:.|          ||.|        |
Human    73 EERSPSFG-----ED-----------YYGPSRSRHRRRSRER----------GPYR--------T 103

  Fly   247 YKHINEVYYAKKKRRAQQTQGDDDSSNKKERKLYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGK 311
            .||.:..:    |||.:........|.:..::......||.....:.:.|:...:||||...:|:
Human   104 RKHAHHCH----KRRTRSCSSASSRSQQSSKRSSRSVEDDKEGHLVCRIGDWLQERYEIVGNLGE 164

  Fly   312 GSFGQVVKAYDHEE-QCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYYIVKLKRHFMWR 375
            |:||:||:..||.. :..||:|||:|...:...|::|:.:|:.:...|.|||:..|.:...|.:.
Human   165 GTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFH 229

  Fly   376 NHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLC 440
            .|:|:.||||..|.::.|:..||:...|...|..|.|||.||.||.  |..:.|.||||||||..
Human   230 GHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHMAYQLCHALRFLH--ENQLTHTDLKPENILFV 292

  Fly   441 NP-----------------KRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDM 488
            |.                 |.::|::.||||:....:.....:.:|.||.|||:|.:.:....|:
Human   293 NSEFETLYNEHKSCEEKSVKNTSIRVADFGSATFDHEHHTTIVATRHYRPPEVILELGWAQPCDV 357

  Fly   489 WSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFF------DKIVADGS 547
            ||:||||.|.:.|..||......:.:..:.::||..|.:::.:..|.:.|:      |:..:||.
Human   358 WSIGCILFEYYRGFTLFQTHENREHLVMMEKILGPIPSHMIHRTRKQKYFYKGGLVWDENSSDGR 422

  Fly   548 YVLKKNQNGRKYKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRV 612
            || |:|     .||..|..|.|.|                    ::::..||:.|||:|||..|:
Human   423 YV-KEN-----CKPLKSYMLQDSL--------------------EHVQLFDLMRRMLEFDPAQRI 461

  Fly   613 TPYYALQHNFF 623
            |...||.|.||
Human   462 TLAEALLHPFF 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mnbNP_728107.2 PKc_DYRK1 289..628 CDD:271128 116/359 (32%)
S_TKc 303..623 CDD:214567 112/343 (33%)
CLK3NP_001123500.2 PKc_CLK3 142..472 CDD:271116 114/357 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155020
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.