| Sequence 1: | NP_001259663.1 | Gene: | CG6769 / 32770 | FlyBaseID: | FBgn0030878 | Length: | 409 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009289663.1 | Gene: | si:dkey-77f5.4 / 100147955 | ZFINID: | ZDB-GENE-131121-70 | Length: | 456 | Species: | Danio rerio |
| Alignment Length: | 227 | Identity: | 48/227 - (21%) |
|---|---|---|---|
| Similarity: | 74/227 - (32%) | Gaps: | 73/227 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 66 NLSVY-------CHACRRQFASQKAHDNHLNSRKHKELLARFEREQMTASGGSA---STATSVCT 120
Fly 121 RSVVEQRPHPALAAAAAGKGRLAFAERVVKANNDEEMVDEDDDDFEDIEEEEVDSDEWDKIPENP 185
Fly 186 LTERDCLFCTHASEDLV-ENLKHMSV-AHS----FFIPDTEYCTDIEGLL-----YYLGEKVANY 239
Fly 240 FICLFCNDRGKTFY---SLDA-VRKHMIDKGH 267 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6769 | NP_001259663.1 | C2H2 Zn finger | 6..28 | CDD:275371 | |
| zf-C2H2_jaz | 70..94 | CDD:288983 | 5/30 (17%) | ||
| C2H2 Zn finger | 71..93 | CDD:275371 | 4/21 (19%) | ||
| zf-C2H2_2 | 191..290 | CDD:289522 | 25/92 (27%) | ||
| si:dkey-77f5.4 | XP_009289663.1 | COG5048 | 82..441 | CDD:227381 | 48/227 (21%) |
| C2H2 Zn finger | 94..114 | CDD:275368 | 4/26 (15%) | ||
| zf-H2C2_2 | 106..131 | CDD:290200 | 4/31 (13%) | ||
| C2H2 Zn finger | 122..142 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 150..170 | CDD:275368 | 7/25 (28%) | ||
| zf-H2C2_2 | 162..187 | CDD:290200 | 8/50 (16%) | ||
| CpXC | 177..>222 | CDD:291051 | 13/50 (26%) | ||
| C2H2 Zn finger | 178..198 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 206..226 | CDD:275368 | 4/19 (21%) | ||
| SIR2 | <221..>273 | CDD:294129 | 13/46 (28%) | ||
| C2H2 Zn finger | 234..254 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 246..271 | CDD:290200 | 7/15 (47%) | ||
| C2H2 Zn finger | 262..282 | CDD:275368 | |||
| C2H2 Zn finger | 290..310 | CDD:275368 | |||
| zf-H2C2_2 | 302..327 | CDD:290200 | |||
| C2H2 Zn finger | 318..338 | CDD:275368 | |||
| zf-H2C2_2 | 330..354 | CDD:290200 | |||
| C2H2 Zn finger | 346..366 | CDD:275368 | |||
| zf-H2C2_2 | 358..383 | CDD:290200 | |||
| C2H2 Zn finger | 374..394 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1383726at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||