DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and ACTL6A

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_004292.1 Gene:ACTL6A / 86 HGNCID:24124 Length:429 Species:Homo sapiens


Alignment Length:476 Identity:83/476 - (17%)
Similarity:159/476 - (33%) Gaps:149/476 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 DDRILRLGAVDARNYDIHFPIQRGELNVHNEKGGSLQASMQHLERIWSYALEERLKIPLRKLGTH 225
            |...||   |...|.:...|::.|.:    |...|.||.:.|     :|.:..:.:..|.     
Human    71 DTNALR---VPRENMEAISPLKNGMV----EDWDSFQAILDH-----TYKMHVKSEASLH----- 118

  Fly   226 CAVLVVNDVYVRRHLREFVT-LLLRRLGFRRCFLVQDSVASTFGAGIGYGCVVDIGAQKTSIACI 289
             .||:....:..|..||.:| |:.........||.:.:|.:.|..|...|.::|.||..|:...:
Human   119 -PVLMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPV 182

  Fly   290 EDGISQLDARVRLSYGGGDLDQVLLLLLRKCGFPYRECNVQESYVDAHLLD-------------E 341
            .||.......|:....|.       .:..:|...::|.|::  .|..:::.             :
Human   183 HDGYVLQQGIVKSPLAGD-------FITMQCRELFQEMNIE--LVPPYMIASKEAVREGSPANWK 238

  Fly   342 LKEKFCHLNAS----VCGAQEKHFNLRKHNGQWLRYTIQVGDEALMAPLALFHTELLNITGRTKA 402
            .|||...:..|    :|....:.|     ....|:.:....||.:.|.:...|.|..|       
Human   239 RKEKLPQVTRSWHNYMCNCVIQDF-----QASVLQVSDSTYDEQVAAQMPTVHYEFPN------- 291

  Fly   403 VFTQQAVQDQYDCEDCFDAEYLK------ETGRKNGVRGGDILQLS----TSAGYQPRPQLPVTA 457
                     .|:|:  |.||.||      :.....|:.|..:|.:|    ||.|           
Human   292 ---------GYNCD--FGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVG----------- 334

  Fly   458 DDEELIVVDQDETISNCQSQLGAQTAGGQMNSNGCYHNGQGLVLPLDQAIIQSINRLSSYETKRK 522
                                                                    :...:.:..
Human   335 --------------------------------------------------------MCDIDIRPG 343

  Fly   523 MFGSILLVGSSAKLPGLAAWLEQRISQQVQSEVNV-LIKG---MDAGMVAWKGAAIMSVLESARE 583
            ::||:::.|.:..:......|.:.:||:....:.: ||..   ::....:|.|.:|::.|.:.::
Human   344 LYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQ 408

  Fly   584 LWISQNDWQRHGLRVLRERSP 604
            :|||:.:::..|.:.:..:.|
Human   409 MWISKQEYEEGGKQCVERKCP 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 71/432 (16%)
ACTL6ANP_004292.1 Actin 11..429 CDD:394979 82/474 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.