DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and ACT8

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_175350.1 Gene:ACT8 / 841347 AraportID:AT1G49240 Length:377 Species:Arabidopsis thaliana


Alignment Length:436 Identity:67/436 - (15%)
Similarity:147/436 - (33%) Gaps:139/436 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 IHFPIQRGELNVHNEKGGSLQASMQHLERIWSYALEERLKIPLRKLGTHCAVLVVNDVYVRRHLR 241
            :.:||:.|           :.::...:|:||.:.....|:|...:   |..:|....:..:.:..
plant    69 LKYPIEHG-----------VVSNWDDMEKIWHHTFYNELRIAPEE---HPVLLTEAPLNPKANRE 119

  Fly   242 EFVTLLLRRLGFRRCFLVQDSVASTFGAGIGYGCVVDIGAQKTSIACIEDGISQLDARVRLSYGG 306
            :...::.........::...:|.|.:.:|...|.|:|.|...:....|.:|.|...|.:||...|
plant   120 KMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFSLPHAILRLDLAG 184

  Fly   307 GDLDQVLLLLLRKCGFPYRECNVQESYVDAHLLDELKEKFCHL---------NASVCGAQEKHFN 362
            .||...|:.:|.:.|:.:      .:..:..::.::|||...:         .:....:.||::.
plant   185 RDLTDYLMKILTERGYMF------TTTAEREIVRDIKEKLSFVAVDYEQEMETSKTSSSIEKNYE 243

  Fly   363 LRKHNGQWLRYTIQVGDEALMAPLALFHTELLNITGRTKAVFTQQAVQDQYDCEDCFDAEYLKET 427
            |  .:||    .|.:|.|....|..||                                      
plant   244 L--PDGQ----VITIGAERFRCPEVLF-------------------------------------- 264

  Fly   428 GRKNGVRGGDILQLSTSAGYQPRPQLPVTADDEELIVVDQDETISNCQSQLGAQTAGGQMNSNGC 492
                                ||                          |.:|.:.||        
plant   265 --------------------QP--------------------------SFVGMEAAG-------- 275

  Fly   493 YHNGQGLVLPLDQAIIQSINRLSSYETKRKMFGSILLVGSSAKLPGLAAWLEQRISQQVQSEVNV 557
                      :.:....||.: ...:.::.::|:|:|.|.:....|:|..:.:.|:....|.:.:
plant   276 ----------IHETTYNSIMK-CDVDIRKDLYGNIVLSGGTTMFSGIADRMSKEITALAPSSMKI 329

  Fly   558 -LIKGMDAGMVAWKGAAIMSVLESARELWISQNDWQRHGLRVLRER 602
             ::...:.....|.|.:|::.|.:.:::|||:.::...|..::..:
plant   330 KVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDEAGPGIVHRK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 64/411 (16%)
ACT8NP_175350.1 NBD_sugar-kinase_HSP70_actin 5..377 CDD:418402 67/436 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.