DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and ARP2

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_189336.1 Gene:ARP2 / 822317 AraportID:AT3G27000 Length:389 Species:Arabidopsis thaliana


Alignment Length:455 Identity:90/455 - (19%)
Similarity:159/455 - (34%) Gaps:161/455 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 DIHFPIQRGELNVHNEKGGSLQASMQHLERIWSYALEERLKI-PLRKLGTHCAVLVVN-DVYVRR 238
            ||::|       |||   |.:| :...:|.:|.:|....||| |     :.|.:|:.: .:...:
plant    67 DINYP-------VHN---GIVQ-NWDDMEHVWDHAFYNELKINP-----SDCKILLTDPPLNPSK 115

  Fly   239 HLREFVTLLLRRLGFRRCFLVQDSVASTFGAGIGYGCVVDIGAQKTSIACIEDGISQLDARVRLS 303
            :..:.:..:..:..|...|:...:|.:.:..|:..|.|:|.|...|.:..:.||.|......|::
plant   116 NREKMIETMFEKYNFAGVFIQIQAVLTLYAQGLLTGLVIDSGDGVTHVVPVVDGYSFPHLTKRMN 180

  Fly   304 YGGGDLDQVLLLLLRKCGFPYRECNVQESYVDAHLLDELKEKFCHLN-----ASVCGAQE----K 359
            ..|..:...|:.||.:.|:      ......|...:.|:|||.|:::     .|..|.:.    |
plant   181 VAGRHITAYLVDLLSRRGY------AMNKTADFETVREIKEKLCYISYDYKRESQLGLETTILVK 239

  Fly   360 HFNLRKHNGQWLRYTIQVGDEALMAPLALFHTELLNITGRTKAVFTQQAVQDQYDCEDCFDAEYL 424
            ::.|  .:|:    .|:||.|...||.|||..||:::.|...|....:.:|:             
plant   240 NYTL--PDGR----VIKVGTERFQAPEALFTPELIDVEGDGMADMVFRCIQE------------- 285

  Fly   425 KETGRKNGVRGGDILQLSTSAGYQPRPQLPVTADDEELIVVDQDETISNCQSQLGAQTAGGQMNS 489
                                                    :|.|                     
plant   286 ----------------------------------------MDID--------------------- 289

  Fly   490 NGCYHNGQGLVLPLDQAIIQSINRLSSYETKRKMFGSILLVGSSAKLPGLAAWLEQRISQQVQSE 554
                                  ||:..|:       .|:|.|.|...|||.:.||:.|..:.   
plant   290 ----------------------NRMMLYQ-------HIVLSGGSTMYPGLPSRLEKEIQDRY--- 322

  Fly   555 VNVLIKGMDAG----------------MVAWKGAAIMSVLESARELWISQNDWQRHGLRVLRERS 603
            ::.::||...|                ||...||.:..:::.|.|.||::.|:...|:..|.:.|
plant   323 LDTVLKGNKDGLKKLRLRIEDPPRRKHMVYLGGAVLAGIMKDAPEFWINREDYMEEGINCLNKMS 387

  Fly   604  603
            plant   388  387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 81/427 (19%)
ARP2NP_189336.1 ACTIN 4..387 CDD:214592 89/453 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.