DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and AT3G18320

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001319580.1 Gene:AT3G18320 / 821361 AraportID:AT3G18320 Length:190 Species:Arabidopsis thaliana


Alignment Length:104 Identity:23/104 - (22%)
Similarity:45/104 - (43%) Gaps:18/104 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   512 NRLSSYETKRKMFGSILLVGSSAKLPGLAAWLEQRISQ-QVQSEVNVLIKGMDAGMVAWKGAAIM 575
            :|||:...::.   |:||||.|.....|  |:..:|.: .|.|...||.......:..|.|.:.:
plant    59 SRLSAVGDEKL---SLLLVGDSTSNTEL--WVTSKIGEANVVSWSKVLSLYPKPNVGFWHGLSFL 118

  Fly   576 SVLESAREL--------WISQNDWQRHGLRVLRERSPFL 606
              |:..:::        |:.:.|  ...:.::.|.:.|:
plant   119 --LDEEKKVLLCCKSKGWMKEED--EDNVYIVGEDTKFI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 22/99 (22%)
AT3G18320NP_001319580.1 FBA_1 7..175 CDD:254394 23/104 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1258783at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.